Recombinant Human Natural cytotoxicity triggering receptor 3 (NCR3), partial

Promotion
Code CSB-MP015551HU1d7
Abbreviation Recombinant Human NCR3 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of NCR3 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Activating natural killer receptor p30;Natural killer cell p30-related protein
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-135aa
Target Protein Sequence
MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG which promote DC maturation.
Gene References into Functions
  1. this paper shows that the decreased expression of activating receptor NKp30 on peripheral blood NK cells is positively associated with gastric cancer progression PMID: 30255106
  2. Low NKp30 expression on NK cells is associated with Nasopharyngeal Carcinoma. PMID: 29580037
  3. we propose NKp30 status as a simple and early prognostic biomarker that identifies intermediate-risk patients with poor prognosis who otherwise may not be identified with existing risk stratification systems. PMID: 28548938
  4. Data indicate a sequence of events driven by tumour-derived prostaglandin D2 (PGD2) associated with engagement of the natural cytotoxicity triggering receptor 3 (NKp30)-B7H6 antigen (B7H6) pathway leading to significant group 2 innate lymphoid cells (ILC2s) activation and expansion. PMID: 28928446
  5. NKp44 and NKp30 splice variants profiles are tissue/condition specific and demonstrate similarity between placenta and cancerous tissues. PMID: 27765926
  6. Results found that rs2736191-C NCR3 carriers had a significant increased number of mild malaria episodes compared to the non-carriers. This SNP had a significantly increased promoter activity in NCR33 gene and involves a binding site for STAT4 and RUNX3. PMID: 29121672
  7. findings show HIV reservoir size is dependent on the presence of a defined NK cell population with a specific transcriptional signature: high NCR (NKp46 and NKp30) and IFN-gamma inducibility upon NCR and cytokine receptor engagement PMID: 28956765
  8. Copy number variations of HLA-I and activation of NKp30 pathway determine the sensitivity of gastric cancer cells to the cytotoxicity of natural killer cells PMID: 26364607
  9. Data suggest that NK cells and NKp30 could play a role in Antisynthetase syndrome pathogenesis. PMID: 27511738
  10. the stalk domains of NKp30 and NKp46, another NCR employing CD3zeta for signaling, were not exchangeable without drastic deficiencies in folding, plasma membrane targeting, and/or ligand-induced receptor signaling. PMID: 27754869
  11. Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells. PMID: 25991472
  12. NKp30-B7-H6 interaction is a novel cell contact mechanism that mediates activation of Group 2 innate lymphoid cells and identifies a potential target for the development of novel therapeutics for atopic dermatitis and other atopic diseases. PMID: 26582946
  13. Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure PMID: 26241657
  14. the interaction between NKp30 and B7-H6 may contribute to the fate of neuroblastoma patients PMID: 25877893
  15. Suggest role for NKp30 isoforms in influencing liver damage and ensuing fibrosis in chronic hepatitis C infection. PMID: 26094914
  16. show that in addition to NKG2D, human CEACAM1 can inhibit NK-cell activation via NKp30 or 2B4 PMID: 25824372
  17. Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms. PMID: 24882570
  18. Tumor-released Galectin-3, a soluble inhibitory ligand of human NKp30, plays an important role in tumor escape from NK cell attack. PMID: 25315772
  19. Allogeneic and xenogeneic anti-tumor effect of callithrix jacchus natural killer cells is dependent on NKp30 and B7-H6 interaction. PMID: 25001651
  20. NKp30 was required for natural killer cell-fungal conjugate formation, phosphatidylinositol 3-kinase (PI3K) signaling, and perforin release. PMID: 24139398
  21. Data indicate that the ectodomain of NKp30 forms functional homo-oligomers that mediate high affinity binding to its corresponding cellular ligand B7-H6. PMID: 24275655
  22. we show for the first time that BAG-6(686-936) comprises a subdomain of BAG-6, which is sufficient for receptor docking and inhibition of NKp30-dependent NK cell cytotoxicity as part of a tumor immune escape mechanism PMID: 24133212
  23. Findings suggest that NK cells may promote an NKp30-dependent inflammatory state in salivary glands and that blockade of the B7H6/NKp30 axis could be clinically relevant in primary Sjogren's syndrome. PMID: 23884468
  24. HHIP, HDAC4, NCR3 and RARB polymorphisms may have a role in impaired lung function that begins in early life PMID: 23456936
  25. These findings reveal that B7-H6 is not only implicated in tumor immunosurveillance but also participates in the inflammatory response in infectious conditions. PMID: 23687088
  26. Cytokine stimulation combined with natural killer cell receptor engagement are required for human natural killer cell functional diversity. PMID: 23490421
  27. data describe immune escape mechanism of monoclonal gammopathy/multiple myeloma occuring via downregulation of 3 major activating NK receptors (NCR3/NKp30, NKG2D and CD244/2B4/p38) in bone marrow, that was undetectable in peripheral blood. PMID: 23360454
  28. Using a codon-optimized gene fragment, we report remarkable yields for extracellular domain of human NK cell receptor (NKp30ex) when produced on M9 minimal medium, even with low (2g/L) glucose concentration. PMID: 23059620
  29. Natural cytotoxicity receptors play a major role in the recognition by NK cells of cancer stem cells targets. PMID: 23345327
  30. B7-H6:7D8 represents the first Ab-based molecule stimulating NKp30-mediated NK cell cytotoxicity for therapeutic purposes PMID: 23066150
  31. The stalk domain and the glycosylation status of the activating natural killer cell receptor NKp30 are important for ligand binding. PMID: 22807449
  32. NKp30 chimeric antigen receptor-expressing T cells produce interferon (IFN)-gamma and kill B7-H6 ligand-expressing tumor cells in vivo. PMID: 22851709
  33. NKp30 expression is significantly increased on the natural killer cells that persist at one week post-liver transplant in pediatric patients. PMID: 22360401
  34. NKp30 is a triggering receptor downstream of adhesion and plays an important role in NK cell activation, degranulation and cytotoxicity. PMID: 22221078
  35. a precise analysis of clinical data showed a correlation between decreased NCR expression and poor prognosis factors such as low haemoglobin level, high (>30x10(9) per litre) lymphocyte count or elevated C-reactive protein PMID: 22044312
  36. alternatively spliced isoforms affect the prognosis of gastrointestinal stromal tumors PMID: 21552268
  37. This study provides insights into NKp30 ligand recognition and a framework for a potential family of unidentified ligands. PMID: 21444796
  38. The NKp30-B7-H6 structure revealed that this NK cell activating complex is distinct from the CTLA4-B7 and PD-1-PD-L T cell inhibitory complexes in both overall organization and detailed atomic interactions that mediate binding and specificity. PMID: 21422170
  39. Observational study of gene-disease association. (HuGE Navigator) PMID: 20712903
  40. NKp30(high) cells are more effective in preventing infection of hepatitis C in high risk intravenous drug addicted individuals. PMID: 20812318
  41. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  42. Observational study of gene-disease association. (HuGE Navigator) PMID: 20587610
  43. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
  44. Observational study of gene-disease association. (HuGE Navigator) PMID: 20663564
  45. Selective cross-talk among natural cytotoxicity receptors (NKp46, NKp30 and NKp44) in human natural killer cells. PMID: 12731048
  46. CD59 is physically associated with NKp46 and NKp30 and activate human nk cell-mediated cytotoxicity. PMID: 14635045
  47. NKG2D, NKp30, NKp44, and NKp46 acitvation affected by ligand-negative phenotype in bone marrow-derived progenitor cells, acquisition of cell-surface ligands during myeloid differentiation, defective expression of ligands on malignant transformation PMID: 15657183
  48. NKp30 is not only a triggering molecule essential for antitumor activity but is also a surface receptor involved in natural killer cell suicide. PMID: 15728472
  49. NK cell-mediated induction of dendritic cell maturation is dependent on NKp30. PMID: 15784725
  50. heparan sulfate glycosaminoglycans are not ligands for NKp30, leaving open the question as to the nature of the cellular ligand for this important NK cell activation receptor PMID: 15972650

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Natural cytotoxicity receptor (NCR) family
Tissue Specificity
Selectively expressed by all resting and activated NK cells and weakly expressed in spleen.
Database Links

HGNC: 19077

OMIM: 609148

KEGG: hsa:259197

STRING: 9606.ENSP00000342156

UniGene: Hs.509513

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*