Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

NECTIN2

Uniprot No.

Q92692

Research Area

Immunology

Alternative Names

CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

32-360aa

Target Protein Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

39.2kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human NECTIN2 protein is a valuable resource for researchers focused on immunology. Nectin-2 (CD112) is expressed in E. coli and encompasses the extracellular domain of the protein (32-360aa), ensuring optimal performance in a variety of applications.

This Recombinant Human NECTIN2 protein is engineered with an N-terminal GST-tag, facilitating effortless purification and detection. With a purity greater than 90% as determined by SDS-PAGE, you can rely on the exceptional quality of this protein for your immunology research needs. Choose from liquid or lyophilized powder formats to suit your experimental requirements and streamline your research process with our Recombinant Human NECTIN2 protein.

Target Background

Function

Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein.; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV).

Gene References into Functions

Nectin-2 mutation in men with severe teratospermia PMID: 28689229
In the infection with 3 MLD50 (50 % mouse lethal dose), effective resistance was not observed in transgenic mice expressing nectin-2Ig. PMID: 28671524
Our data provide important structural and biochemical determinants responsible for the recognition of nectin-2 by TIGIT. PMID: 27978489
Chromosomal breakpoints involved the PVRR2 gene in 19q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
energetic basis for the TIGIT/nectin-2 interaction and revealed that an "aromatic key" of nectin-2 is critical for this interaction, whereas variations in the lock were tolerated. PMID: 28515320
PVRL2 is a plasma cholesterol-responsive gene acting at endothelial sites of vascular inflammation to regulate transendothelial migration of leukocytes. PMID: 28062492
Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients. PMID: 26184725
Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection. PMID: 26982466
PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation. PMID: 24116228
Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system. PMID: 23465821
Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion. PMID: 22927415
a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate PMID: 20662561
The CD112 is highly expressed in colon carcinoma tissues and cell lines. PMID: 20617580
The authors now show that human cytomegalovirus targets CD112 for proteasome-mediated degradation by 48 h post-infection, thus removing both activating ligands for DNAM-1 from the cell surface during productive infection. PMID: 20410314
differences in the N termini of herpes simplex virus type 1 and 2 gDs that influence functional interactions with the human entry receptor Nectin-2 PMID: 12915581
There is an allelic association of sequence variation in PVRL2 and the severity of multiple sclerosis. PMID: 16738668
CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process PMID: 16831868
identified PVRL2 as a new recurrent partner gene of the TRA@ locus in peripheral T-cell lymphoma PMID: 17696193
Crystallization and preliminary X-ray analysis of the V domain of human nectin-2 are reported. PMID: 19478445
Regions of nectin-2 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical. PMID: 12438620

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Nectin family

Tissue Specificity

Ubiquitous.

Database Links

HGNC: 9707

OMIM: 600798

KEGG: hsa:5819

STRING: 9606.ENSP00000252483

UniGene: Hs.655455

Code	CSB-EP835690HU
Abbreviation	Recombinant Human NECTIN2 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Nectin-2 (PVRL2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage