Recombinant Human Nectin-2 (PVRL2), partial

Code CSB-EP835690HU
Abbreviation Recombinant Human NECTIN2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
CD 112; CD112; CD112 antigen; Herpes virus entry mediator B; Herpes virus entry protein B; Herpesvirus entry mediator B; Herpesvirus entry protein B; Hve B; HveB; Nectin-2; Nectin2; Poliovirus receptor like 2; Poliovirus receptor related 2 (herpesvirus entry mediator B); Poliovirus receptor related 2; Poliovirus receptor related protein 2; Poliovirus receptor-related protein 2; PRR 2; PRR2; PVRL 2; PVRL2; PVRL2_HUMAN; PVRR 2; PVRR2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
32-360aa
Target Protein Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.2kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human NECTIN2 protein is a valuable resource for researchers focused on immunology. Nectin-2 (CD112) is expressed in E. coli and encompasses the extracellular domain of the protein (32-360aa), ensuring optimal performance in a variety of applications.

This Recombinant Human NECTIN2 protein is engineered with an N-terminal GST-tag, facilitating effortless purification and detection. With a purity greater than 90% as determined by SDS-PAGE, you can rely on the exceptional quality of this protein for your immunology research needs. Choose from liquid or lyophilized powder formats to suit your experimental requirements and streamline your research process with our Recombinant Human NECTIN2 protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein.; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV).
Gene References into Functions
  1. Nectin-2 mutation in men with severe teratospermia PMID: 28689229
  2. In the infection with 3 MLD50 (50 % mouse lethal dose), effective resistance was not observed in transgenic mice expressing nectin-2Ig. PMID: 28671524
  3. Our data provide important structural and biochemical determinants responsible for the recognition of nectin-2 by TIGIT. PMID: 27978489
  4. Chromosomal breakpoints involved the PVRR2 gene in 19q31 is associated with Diffuse Large B-Cell Lymphomas. PMID: 27356265
  5. energetic basis for the TIGIT/nectin-2 interaction and revealed that an "aromatic key" of nectin-2 is critical for this interaction, whereas variations in the lock were tolerated. PMID: 28515320
  6. PVRL2 is a plasma cholesterol-responsive gene acting at endothelial sites of vascular inflammation to regulate transendothelial migration of leukocytes. PMID: 28062492
  7. Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients. PMID: 26184725
  8. Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection. PMID: 26982466
  9. PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
  10. Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation. PMID: 24116228
  11. Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system. PMID: 23465821
  12. Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion. PMID: 22927415
  13. a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate PMID: 20662561
  14. The CD112 is highly expressed in colon carcinoma tissues and cell lines. PMID: 20617580
  15. The authors now show that human cytomegalovirus targets CD112 for proteasome-mediated degradation by 48 h post-infection, thus removing both activating ligands for DNAM-1 from the cell surface during productive infection. PMID: 20410314
  16. differences in the N termini of herpes simplex virus type 1 and 2 gDs that influence functional interactions with the human entry receptor Nectin-2 PMID: 12915581
  17. There is an allelic association of sequence variation in PVRL2 and the severity of multiple sclerosis. PMID: 16738668
  18. CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process PMID: 16831868
  19. identified PVRL2 as a new recurrent partner gene of the TRA@ locus in peripheral T-cell lymphoma PMID: 17696193
  20. Crystallization and preliminary X-ray analysis of the V domain of human nectin-2 are reported. PMID: 19478445
  21. Regions of nectin-2 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical. PMID: 12438620

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Nectin family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 9707

OMIM: 600798

KEGG: hsa:5819

STRING: 9606.ENSP00000252483

UniGene: Hs.655455

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*