Recombinant Human Norrin (Ndp)

In Stock
Code CSB-EP015609HU
Abbreviation Recombinant Human Ndp protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Ndp
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Norrie disease protein)(X-linked exudative vitreoretinopathy 2 protein)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-133aa
Target Protein Sequence
KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The formation of the recombinant plasmid by co-incorporating the gene encoding the human Norrin (NDP) (25-133aa) with the N-terminal 10xHis-GST-tag gene and C-terminal Myc-tag gene into a plasmid vector initiates the generation of the recombinant human NDP protein. Transforming the recombinant plasmid into E.coli cells and then selecting the positive E.coli cells based on their ability to survive in the presence of a specific antibiotic. The positive E.coli cells are cultured under conditions that stimulate the expression of the gene of interest. After expression, affinity purification is employed to isolate and purify the recombinant human NDP protein from the cell lysate. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant human NDP protein, revealing a purity level exceeding 85%.

NDP is a multifunctional protein involved in various cellular processes. Initially considered a housekeeping enzyme essential for DNA and RNA synthesis, recent studies have revealed its involvement in cellular regulatory functions such as growth control, developmental control, and tumor metastasis suppression [1]. NDP kinase is known for its catalytic activity of nucleotide phosphotransfer, but it also carries out other functions beyond its catalytic activity, indicating its multifunctionality [2]. Furthermore, it has been reported that NDP kinase may have multiple regulatory functions besides the phosphotransferase activity and behaves as a tumor metastasis suppressor [3]. Additionally, NDP kinase has been found to interact with vimentin intermediate filaments and energy metabolism enzymes in a tissue-specific manner, suggesting its tissue-specific roles [4]. Moreover, NDP kinase has been implicated in transmembrane signaling, indicating its involvement in diverse cellular processes [5]. Studies have also suggested that NDP kinases are multifunctional proteins and some of their functions operate via the interaction with G-proteins [6]. Furthermore, NDP kinase has been identified as a tumor metastasis suppressor, a morphological regulator, a transcription factor, and a differentiation inhibitor, indicating its involvement in different levels of cellular regulation [7]. Additionally, it has been reported that NDP kinases can participate in phosphorelay networks that regulate gene expression and metabolism [8]. These findings collectively demonstrate the multifunctional nature of NDP kinase and its involvement in various cellular processes beyond its traditional role in nucleotide metabolism.

References:
[1] Q. Lü, H. Park, L. Egger, & M. Inouye, Nucleoside-diphosphate kinase-mediated signal transduction via histidyl-aspartyl phosphorelay systems in escherichia coli, Journal of Biological Chemistry, vol. 271, no. 51, p. 32886-32893, 1996. https://doi.org/10.1074/jbc.271.51.32886
[2] S. Mesnildrey, F. Agou, A. Karlsson, D. Bonne, & M. Véron, Coupling between catalysis and oligomeric structure in nucleoside diphosphate kinase, Journal of Biological Chemistry, vol. 273, no. 8, p. 4436-4442, 1998. https://doi.org/10.1074/jbc.273.8.4436
[3] N. Ishikawa, H. Taniguchi-Seto, Y. Munakata, Y. Takagi, N. Shimada, & N. Kimura, Multiple transcripts for rat nucleoside diphosphate kinase α isoform are structurally categorized into two groups that exhibit cell-specific expression and distinct translation potential, Journal of Biological Chemistry, vol. 272, no. 6, p. 3289-3295, 1997. https://doi.org/10.1074/jbc.272.6.3289
[4] A. Otero, Copurification of vimentin, energy metabolism enzymes, and a mer5 homolog with nucleoside diphosphate kinase, Journal of Biological Chemistry, vol. 272, no. 23, p. 14690-14694, 1997. https://doi.org/10.1074/jbc.272.23.14690
[5] L. Xu, J. Murphy, & A. Otero, Participation of nucleoside-diphosphate kinase in muscarinic k+ channel activation does not involve gtp formation, Journal of Biological Chemistry, vol. 271, no. 35, p. 21120-21125, 1996. https://doi.org/10.1074/jbc.271.35.21120
[6] N. Orlov, T. Orlova, Y. Reshetnyak, E. Burstein, & N. Kimura, Interaction of recombinant rat nucleoside diphosphate kinase α with bleached bovine retinal rod outer segment membranes: a possible mode of ph and salt effects, Iubmb Life, vol. 41, no. 1, p. 189-198, 1997. https://doi.org/10.1080/15216549700201191
[7] N. Orlov, T. Orlova, K. Nomura, N. Hanai, & N. Kimura, Transducin‐mediated, isoform‐specific interaction of recombinant rat nucleoside diphosphate kinases with bleached bovine retinal rod outer segment membranes, Febs Letters, vol. 389, no. 2, p. 186-190, 1996. https://doi.org/10.1016/0014-5793(96)00575-3
[8] M. Levit, B. Abramczyk, J. Stock, & E. Postel, Interactions between escherichia colinucleoside-diphosphate kinase and dna, Journal of Biological Chemistry, vol. 277, no. 7, p. 5163-5167, 2002. https://doi.org/10.1074/jbc.m111170200"

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. Plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. Acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). May be involved in a pathway that regulates neural cell differentiation and proliferation. Possible role in neuroectodermal cell-cell interaction.
Gene References into Functions
  1. NDP is a potent trigger of FZD4 ubiquitination and induces internalization of the NDP receptor complex into the endo-lysosomal compartment. of ubiquitinated cargo transport through the multivesicular body (MVB) pathway using a dominant negative ESCRT (endosomal sorting complexes required for transport) component VPS4 EQ strongly impairs NDP/FZD4 signalling in vitro. PMID: 28675177
  2. A novel mutation was found in the NDP gene in the affected males of the family. As the mutation was absent in the normal male members of the family, it should be the genetic cause of the disease. PMID: 28922694
  3. The genetic analysis of the NDP gene enabled to identify the novel frameshift mutation c.222_c223insCG in p1 leading to the premature stop codon and production of aberrant norrin protein. In P2, clinical presentation included high myopia with astigmatism, unilateral fibrous bands and retinal detachment. Genetic testing revealed known point mutation c.362G>A leading to amino-acid alteration and improper protein. Conclus PMID: 30088388
  4. The patient with whole NDP gene deletion did not exhibit any apparent extraocular defects (like mental retardation or sensorineural hearing loss) during his first decade of life, and this is considered to be a notable finding. Our study also provides evidence emphasizing the need for genetic testing which could eliminate ambiguities in clinical diagnosis and detect carrier status, thereby aiding the patient and family mem PMID: 28602015
  5. The screening of candidate genes namely NDP, FZD4 and TSPAN12 led to the identification of six major coding region variants in 36 ROP probands. PMID: 28982955
  6. c.314C>A mutation of NDP gene is a novel mutation and broadens the genetic spectrum of Norrie disease. PMID: 29133643
  7. Probands with LRP5 or NDP mutations were mainly categorized into group III and IV, TSPAN12 mutations were mainly observed in probands with group IV and V FEVR. PMID: 29181528
  8. The mutation c.310A>C (p.Lys104Gln) in exon 3 of NDP is associated with familial exudative vitreoretinopathy in the studied family PMID: 27720678
  9. Among the detected mutations, LRP5 accounted for the largest proportion with a mean mutation rate of 16.1% (5/31, 16.1%), followed by NDP (3/31, 9.7%), FZD4 (2/31, 6.5%), TSPAN12 (1/31, 3.2%), and KIF11 (1/31, 3.2%). All the novel changes were predicted to be pathogenic by a series of bioinformatics analyses. PMID: 28494495
  10. we reported a novel missense NDP mutation of a familial case of Norrie Disease in a Chinese family. PMID: 26547627
  11. hemizygous pathogenic variant in NDP, c.293 C>T, p.(Pro98Leu) was identified in two brothers with isolated bilateral microphthalmia and sclerocornea. PMID: 26130484
  12. First study to demonstrate the involvement of NDP among patients with Indian familial exudative vitreoretinopathy (FEVR) that further expands its mutation spectrum. PMID: 27217716
  13. These structural, biophysical and cellular data, map Fz4 and putative Lrp5/6 binding sites to distinct patches on Norrin, and reveal a GAG binding site spanning Norrin and Fz4 cysteine-rich domain. PMID: 26158506
  14. Genetic evaluation of a case of bilateral leukocoria and asymmetric microphthalmia revealed a previously undescribed mutation in the Norrie disease protein gene. PMID: 26459204
  15. Norrin may play a role in the regulation of angiogenesis. PMID: 25005225
  16. a novel c.277T>C missense mutation causing the substitution of a hydrophobic cysteine to a hydrophilic arginine [p.(Cys93Arg)]in patients with Norrie disease. PMID: 24801666
  17. Norrie disease was diagnosed in three patients from a Japanese family by clinical examination and was confirmed by genetic analysis. PMID: 25023092
  18. Norrin induces the formation of a ternary complex with Fz4 and Lrp5/6 by binding to their respective extracellular domains PMID: 24186977
  19. Report of a missense mutation, p.Arg41Ser, in NDP causing Norrie disease in an Indian family. PMID: 22674248
  20. Multi-functional norrin is a ligand for the LGR4 receptor. PMID: 23444378
  21. NDP mutations are common cause of Norrie disease but might be rare cause for familial exudative vitreoretinopathy (FEVR) in Chinese. PMID: 22563645
  22. In cases of dysplastic retinas with bilateral multiple unclear pseudotumourous lesions, cytology seems to be a useful tool to differentiate in a very short term patients with Norrie's syndrome from those with retinoblastoma or lymphoma. PMID: 21159148
  23. Norrin has a neuroprotective role for retinal neurons independent from its role on the growth of retinal capillaries. PMID: 22183393
  24. Mutation screening of the NDP gene identified a novel nonsense mutation, c.343C>T. PMID: 21179243
  25. A novel Norrin missense mutation, p.Arg41Thr, was identified in two apparently unrelated families with Norrie disease PMID: 20491809
  26. Studies report 21 novel variants for FZD4, LRP5, and NDP. PMID: 20340138
  27. family harboring a single base-pair deletion, c.268delC, in the NDP gene causing a severe Norrie disese phenotype in the male proband and peripheral retinal vascular abnormalities with dragged maculae similar PMID: 20227630
  28. Norrin has pronounced neuroprotective properties on retinal neurons. The effects of Norrin involve activation of Wnt/beta-catenin signaling and subsequent induction of neurotrophic growth factors in Muller cells. PMID: 20427659
  29. Norrin is a potent factor that induces angiogenesis in microvascular and endothelial cells following oxygen-induced retinal vessel loss. PMID: 20053900
  30. de novo mutations in the 5' regulatory region in retinopathy of prematurity PMID: 11748312
  31. Data show a strong association between the AA genotype of the C597A Norrie disease gene polymorphism and progression of retinopathy of prematurity. PMID: 12145535
  32. No Norrie Disease (ND) gene mutations were detected. PMID: 12546446
  33. DNA sequencing demonstrated a novel missense mutation (703G>T) that significantly alters predicted protein structure. PMID: 15609522
  34. Here we report two novel mutations in the NDP gene in Mexican patients and propose that GeneScan is a viable mean of establishing ND carrier status. PMID: 15799735
  35. NDP polymorphisms may play a role in the pathogenesis of retinopathy of prematurity, but do not appear to be a major causative factor. PMID: 16052165
  36. We discuss Wnts and a novel Frizzled ligand, Norrin, in physiological and pathological angiogenesis. PMID: 16714476
  37. We found genetic testing of NDP to be helpful in confirming the diagnosis of X-linked FEVR (familial exudative vitreoretinopathy) in male patients, especially when limited family history was available. PMID: 17050281
  38. Norrin binds to the Frizzled4 cysteine-rich domain (CRD) and does not detectably bind to 14 other mammalian Frizzled and secreted Frizzled-related protein CRDs. PMID: 17158104
  39. Patients exhibiting severe retinal dysgenesis should be suspected of carrying a mutation that disrupts the cysteine-knot motif in the NDP gene. PMID: 17296899
  40. These observations indicate that mutations of the NDP gene can cause ND(Norrie disease) and 6% of FEVR(familial exudative vitreoretinopathy) cases in the Japanese population. PMID: 17325173
  41. A novel missense mutation at position c.134T > A resulting in amino acid change at codon V45E in Norrie disease with neurological disorder and infantile spasms. PMID: 17334993
  42. Norrin mutants demonstrated variable effects on signal transduction, and no apparent correlation with clinical phenotypes was observed. PMID: 17955262
  43. correlation of ophthalmic examination with carrier status for asymptomatic females from a family known to harbor a severe ND gene mutation (C95F) PMID: 18387409
  44. We report a novel mutation in the NDP gene in a patient whose presentation demonstrates the phenotypic heterogeneity of NDP-related disorders. PMID: 19373682

Show More

Hide All

Involvement in disease
Norrie disease (ND); Vitreoretinopathy, exudative 2 (EVR2)
Subcellular Location
Secreted.
Tissue Specificity
Expressed in the outer nuclear, inner nuclear and ganglion cell layers of the retina, and in fetal and adult brain.
Database Links

HGNC: 7678

OMIM: 300658

KEGG: hsa:4693

STRING: 9606.ENSP00000367301

UniGene: Hs.522615

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*