Recombinant Human Parathyroid hormone (PTH) (Active)

In Stock
Code CSB-MP018987HU
Abbreviation Recombinant Human PTH protein (Active)
MSDS
Size $116
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Human PTH1R(CSB-MP018988HU) at 5 μg/ml can bind Human PTH. The EC50 is 3.156-3.564 μg/ml. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human PTH1R(CSB-MP018988HU) at 5 μg/mL can bind Human PTH. The EC50 is 3.156-3.564 μg/mL.
Target Names
Uniprot No.
Alternative Names
Parathyroid hormone; PTH; Parathormone; Parathyrin; PTH
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
32-115aa
Target Protein Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Mol. Weight
38.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Parathyroid hormone regulates calcium homeostasis and bone metabolism through activation of PTH1R, making receptor-binding fidelity critical for mechanistic studies of mineral metabolism and skeletal physiology. This recombinant protein spans the complete mature sequence (aa 32–115) and demonstrates quantified receptor engagement with an EC50 of 3.156–3.564 μg/mL in functional ELISA against immobilized human PTH1R, providing a validated basis for receptor competition assays and structure-function investigations of PTH–PTH1R interactions. The low endotoxin burden (less than 1.0 EU/μg) aligns with standards expected in cell-based cAMP signaling assays and in vivo pharmacology models where inflammatory interference must be minimized. Purity exceeding 90% by SDS-PAGE, combined with the demonstrated receptor-binding activity, supports use in antibody development campaigns and as an immunoassay standard for quantifying endogenous PTH in experimental samples.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Gene References into Functions
  1. Among subjects with preserved renal function, PTH levels were possibly associated with metabolic syndrome in females, whereas vitamin D levels exhibited a possible link to metabolic syndrome in males. PMID: 29348466
  2. Data suggest that, in pregnant women with largely sufficient calcium intakes (via diet and dietary supplements), serum 25-hydroxyvitamin D (total of 25[OH]D2 and 25[OH]D3) is important for maintaining normal serum PTH levels; this study was conducted in group of white-skinned women at northern latitudes in Ireland. PMID: 30018262
  3. In conclusion, Fetuin A, vitamin D, and intact PTH levels were all associated with sarcopenia in this geriatric population. Among them, intact PTH specifically indicates patients with sarcopenic left ventricular hypertrophy. PMID: 28112206
  4. Dkk-1 and PTH levels in psoriatic arthritis are lower than healthy female controls, in contrast with rheumatoid arthritis, in which they are increased PMID: 28634697
  5. Scientific evidence of genetic association of serum PTH level among individuals with different pathologic conditions remains deficient and published results provide weak evidence (review and meta-analysis). PMID: 29794776
  6. Clinical data on secondary hyperparathyroidism, mainly derived from patients with chronic kidney disease, indicate a potential inverse association between leptin (LEP) and parathyroid hormone (PTH) in some, but not all studies. [REVIEW] PMID: 28730419
  7. Parathyroid hormone controls bone and kidney homeostasis via GNAS and Gq-G11 heterotrimeric G proteins. (Review) PMID: 28363951
  8. Patients with chronic kidney disease undergoing parathyroidectomy for primary hyperparathyroidism have similar intraoperative parathyroid hormone degradation kinetics to those with normal kidney function. PMID: 29128188
  9. PTH levels are significantly higher in untreated sustained hypertension patients than white-coat hypertension patients and normotensive subjects. PMID: 29176783
  10. results revealed that PTH treatment on HCs, either continuous or pulsatile, does not exhibit any positive effect, and indicates that exogenous PTH administration after fracture has no effect on HCs. PTH may not have a positive effect at the fracture site during the early stage of fracture healing in which haematoma formation occurs. PMID: 24039091
  11. Pre-incubation of muscle fibers or myotubes with physiological concentrations of PTH, concentration-dependently reduced uptake of labelled 25-hydroxyvitamin D3. PMID: 28104493
  12. Baseline PTH level was not associated with changes in frailty status in men. PMID: 28609827
  13. Elevated PTH induces the transition of endothelial cells to chondrogenic cells via endothelial-mesenchymal transition, possibly mediated by the nuclear translocation of beta-catenin. PMID: 27582099
  14. Cys mutation at the 25th residue of hPTH(1-34) may result in a high bone mass phenotype. PMID: 27300576
  15. Common genetic variants located near genes involved in vitamin D metabolism and calcium and renal phosphate transport associated with differences in circulating parathyroid hormone concentrations PMID: 27927781
  16. PTH pretreatment prevented TGF-beta1 and high glucose-induced Smad2/3 phosphorylation and consequent upregulation of fibronectin and type IV collagen within 4 h. PMID: 27530924
  17. FGFR1c and PTHR signaling pathways converge on NHERF1 to inhibit PTH- and FGF23-sensitive phosphate transport and down-regulate NPT2A. PMID: 27432882
  18. The present study supports the independent pathogenic effect of rs6254GA polymorphism on the development and severity of bone mineral density complications in patients with asymptomatic but not normocalcemic hyperparathyroidism. PMID: 27756092
  19. In patients receiving dual antiplatelet therapy for coronary artery disease, higher PTH levels are associated with an increased ADP-mediated platelet reactivity and suboptimal response to clopidogrel. PMID: 27086085
  20. Parathyroid hormone gene rs6256 variants are not associated with susceptibility to colorectal cancer PMID: 25124570
  21. PTH levels were significantly higher in patients with aldosterone producing adenomas. PMID: 26304960
  22. Although there was a trend for a negative association in women, no statistically significant association was found between endogenous PTH and knee osteoarthritis. PMID: 25879737
  23. The purpose of this study was to investigate the prevalence of adenomatous colon polyps (ACP) as they occur in subjects with diabetes mellitus (DM) and chronic kidney disease. PMID: 27993873
  24. PTH [parathyroid hormone]together with other markers of heart failure may provide valuable information both in the diagnosis and staging of heart failure syndromes PMID: 27546695
  25. Patients with a serum PTH decrease to low values after 1 year of hemodialysis treatment are at high risk of short-term cardiovascular death. PMID: 26880460
  26. a cell model of human dermal fibroblasts in order to investigate the functions of sclerostin, is reported. PMID: 26851122
  27. recombinant human klotho inhibits the expression of 1-OH by PTH both in vitro and in vivo. PMID: 26287968
  28. results suggest that NO-mediated vasorelaxation plays partly a role in the anabolic action of PTH on cortical bone PMID: 26834008
  29. In this large community-based cohort, PTH levels, overall, were not independently associated with the risk of hypertension. However, we found some evidence that PTH may be associated with hypertension in blacks. PMID: 26867053
  30. The objective of this article is to investigate the effect of renin-angiotensin system inhibitors (RASIs) on intact parathyroid hormone (iPTH) levels in continuous ambulatory peritoneal dialysis (CAPD) patients. PMID: 25271253
  31. PTH does not contribute to the occurrence of metabolic components of obesity, but there is a positive correlation between 25(OH)D and HDL-C. PMID: 26451492
  32. Data suggest that effects of PTH on bone remodeling are mediated not only by osteoblasts/osteocytes but also by T-lymphocytes in bone marrow; T-lymphocytes regulate differentiation/life span of stromal cells and their responsiveness to PTH. [REVIEW] PMID: 26662934
  33. Serum secreted i-PTH level might not be predictable by a total mass of parathyroid glands or by their blood supply. PMID: 26997379
  34. A Homozygous [Cys25]PTH(1-84) Mutation That Impairs PTH/PTHrP Receptor Activation Defines a Novel Form of Hypoparathyroidism. PMID: 25891861
  35. Study indicates significant association between specific PTH gene promoter region variants and altered levels of 25(OH)D and vitamin D deficiency among specific nationals. PMID: 26339419
  36. Elevation of PTH, unlike vitamin D, is independently associated with Chronic Obstructive Pulmonary Disease (COPD) severity, and may be a better biomarker for COPD. PMID: 26398210
  37. Abnormal diurnal patterns of PTH are associated with sustained mild hypercalcemia in nondialyzed chronic kidney disease patients. PMID: 27012036
  38. These data indicate that ephrinB2/EphB4 signaling within the osteoblast lineage is required for late stages of osteoblast differentiation. PMID: 23165727
  39. Serum 25(OH)D levels were inversely associated with serum PTH and bone mineral density. PMID: 23045165
  40. Elevated parathyroid hormone serum concentrations might have a role in colorectal cancer development as indicated by higher rates of adenomas, specifically with dysplasia, in women. PMID: 26021763
  41. the iPTH level in ESRD patients carrying VDR BsmI Bb genotype was higher than that in ESRD patients carrying bb genotype in overall populations and in Caucasians PMID: 25007156
  42. The identification of PTH and other hormonal resistances implies to look for the genetic disorder supporting the metabolic disorder--{REVIEW} PMID: 25913526
  43. Intraoperative PTH monitoring during parathyroidectomy to determine PTH clearance proved to be a feasible marker for adequacy and safety of surgery and "cure". PMID: 25241609
  44. Data suggest serum PTH level is independently associated with bone mineral density (BMD) in vitamin D-sufficient women and vitamin D-insufficient women; no association was found in men; high serum PTH is detrimental on BMD in postmenopausal women. PMID: 25242259
  45. In a racially/ethnically diverse population without prevalent cardiovascular disease, higher serum PTH concentration was associated with increased left ventricular mass and increased risk of incident heart failure. PMID: 25468653
  46. In a large community-based sample of elderly, calcium was independently associated with increased arterial stiffness, and PTH independently to intra-arterial peripheral and calculated central blood pressures. PMID: 25562577
  47. Suggest that measurement of iPTH may be useful for assessment of mineral bone disorder in patients with chronic kidney disease. PMID: 26299086
  48. A detailed characterization of in vitro generated amyloid fibrils from human parathyroid hormone (hPTH(1-84)). PMID: 25554227
  49. salt bridge between Arg-20 on parathyroid hormone (PTH) and Asp-137 on the PTH1 receptor is essential for full affinity. PMID: 25218037
  50. A panel of easily assessable determinants could account for both a substantial proportion of PTH variance and the occurrence of secondary hyperparathyroidism. PMID: 24202062

Show More

Hide All

Involvement in disease
Hypoparathyroidism, familial isolated (FIH)
Subcellular Location
Secreted.
Protein Families
Parathyroid hormone family
Database Links

HGNC: 9606

OMIM: 146200

KEGG: hsa:5741

STRING: 9606.ENSP00000282091

UniGene: Hs.37045

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*