Recombinant Human Proteasome activator complex subunit 1 (PSME1)

Code CSB-EP018915HU
Abbreviation Recombinant Human PSME1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
11S regulator complex alpha subunit; 11S regulator complex subunit alpha; 29 kD MCP activator subunit; 29kD MCP activator subunit; Activator of multicatalytic protease subunit 1; IFI5111; IGUP I-5111; Interferon gamma IEF SSP 5111; Interferon gamma inducible protein 5111; Interferon gamma up regulated I 5111 protein; Interferon gamma up-regulated I-5111 protein; MGC8628; PA28a; PA28alpha; Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha); Proteasome activator 28 subunit alpha; Proteasome activator complex subunit 1; Proteasome activator subunit 1; PSME1; PSME1_HUMAN; REG-alpha; REGalpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-249aa
Target Protein Sequence
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
Gene References into Functions
  1. Such a modulation of proteasome activity is explained, at least in part, by the circadian expression of both Nuclear factor (erythroid-derived 2)-like 2 (Nrf2) and the proteasome activator PA28ab PMID: 26944190
  2. Results show that PA28alpha was found to be overexpressed in oral squamous cell carcinoma cell lines and tumor tissues. High expression of PA28alpha was significantly associated with recurrence and poorer overall survival. PMID: 26892607
  3. Constitutive expression of PA28 and ERAP1 in melanoma cells indicate that both interfere with MART-1(26-35) epitope generation even in the absence of IFN-gamma PMID: 26399368
  4. PA28 is a tumor marker and a potential target for therapeutic intervention in prostate cancer. PMID: 23918357
  5. Reduction in ATP levels triggers immunoproteasome activation by the 11S (PA28) regulator during early antiviral response mediated by IFNbeta in mouse pancreatic beta-cells. PMID: 23383295
  6. the first evidence of a novel ovarian cancer-specific marker PMID: 22532226
  7. PA28 selectively up-regulates the presentation of viral MHC class I epitopes and that down regulation PA28 in tumor cells results in impaired presentation of a human TRP2 tumor antigen. PMID: 12200048
  8. The relationship between anti-PA28alpha and Ki antibodies suggests the importance of an antigen-driven system in the induction of an autoimmune response to PA28 complex. PMID: 14760793
  9. DJ-1 and PA28alpha may have roles in the onset of hepatocarcinogenesis PMID: 17671684
  10. the 11S proteasome activator complex, Reg alpha fragment, may have a role in ovarian cancer PMID: 17939699
  11. bortezomib-adapted HL-60 cells showed increased expression and proteasome association of the 11S proteasome activator PMID: 19225532

Show More

Hide All

Protein Families
PA28 family
Database Links

HGNC: 9568

OMIM: 600654

KEGG: hsa:5720

STRING: 9606.ENSP00000372155

UniGene: Hs.75348

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*