Recombinant Human Protein S100-A3(S100A3)

Code CSB-EP020631HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P33764
Relevance Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Protein S-100E S100 calcium-binding protein A3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Research Area Signal Transduction
Source E.coli
Gene Names S100A3
Protein Names Recommended name: Protein S100-A3 Alternative name(s): Protein S-100E S100 calcium-binding protein A3
Expression Region 1-101aa
Tag Info N-terminal GST-tagged
Mol. Weight 38.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Subcellular Location Cytoplasm
Protein Families S-100 family
Tissue Specificity Skin specific, specifically expressed at the inner endocuticle of hair fibers.
Database Links

HGNC: 10493

OMIM: 176992

KEGG: hsa:6274

STRING: 9606.ENSP00000357701

UniGene: Hs.557609

Related Products

S100A3 Antibodies

S100A3 Antibodies for Homo sapiens (Human)

S100A3 Antibodies for Human

S100A3 Proteins

S100A3 Proteins for Homo sapiens (Human)

S100A3 ELISA Kit

S100A3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.