Recombinant Human Protein S100-A8 (S100A8)

Code CSB-YP020641HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP020641HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP020641HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP020641HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP020641HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Protein S100-A8; Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); S100A8; CAGA, CFAG, MRP8
Species
Homo sapiens (Human)
Expression Region
1-93aa
Target Protein Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve proinflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. The iNOS-S100A8/A9 transnitrosylase complex directs selective inflammatory stimulus-dependent S-nitrosylation of GAPDH and probably multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity.; (Microbial infection) Upon infection by human coronavirus SARS-CoV-2, may induce expansion of aberrant immature neutrophils in a TLR4-dependent manner.
Gene References into Functions
  1. Study found that that the co-stimulation with both advanced glycation end-products and Porphyromonas gingivalis LPS increased S100A8 and S100A9 mRNA expression in gingival epithelial cells. These results demonstrated that the upregulation of calprotectin in gingival epithelial cells may primarily function intracellularly in this tissue and may contribute to the pathological process of periodontitis. PMID: 28771806
  2. Our results showed that S100A8/A9, absent or present at very low level in skin biopsies from healthy subjects, is dramatically upregulated in each epidermal layer from psoriatic patients. PMID: 29605872
  3. The results suggest that the calcium-binding proteins S100A8 and S100A9 in myeloid cells have an immune regulatory effect. PMID: 29933628
  4. Median MRP8/14 levels were higher in patients with Takayasu arteritis. PMID: 29196802
  5. S100A8 gene knockdown reduced cell proliferation in the HEC-1A cells compared with control cells, induced cell apoptosis, inhibited the phosphorylation of protein kinase B (Akt), and induced the expression of pro-apoptotic genes. PMID: 29595187
  6. Wide intra- and interindividual differences in calprotectin concentrations in the meconium may reflect intestinal inflammation associated with the fetal adaptation to life outside the uterus. PMID: 28463850
  7. Salivary calprotectin levels were significantly higher in RAS [Recurrent aphthous stomatitis] group (23.72 +/- 4.28 mg/L) compared to the HC [Healthy Controls] (21.59 +/- 4.27 mg/L) (P = 0.013). No significant relationship was found between calprotectin levels and age or gender in both groups (P >0.05). PMID: 29519972
  8. the levels of S100A8 and S100A9 in the sera, and calprotectin levels in the sera and urines of bladder cancer patients, were determined. PMID: 28609200
  9. MRP-8/14 concentration increases in coronary artery blood in association with thrombus formation in acute coronary syndrome. PMID: 28986057
  10. ANGPTL6, S100A8 and S100A9 are overexpressed in skin of psoriasis patients versus zero expression in controls. PMID: 27698489
  11. Elevated breast cancer cell and stromal S1008 protein expression are significant indicators of poorer outcomes in early stage breast cancer patients. Evaluation of S100A8 protein expression may provide additional prognostic information beyond traditional breast cancer prognostic biomarkers. PMID: 28717852
  12. S100A8 was required for laser-induced new collagen synthesis in skin cells. PMID: 29270708
  13. S100A8 methylation has a role in diagnosis and prognosis of hepatocellular carcinoma PMID: 27462864
  14. This study demonstrated that S100A8 was detected in the serums of Alzheimer disease patients PMID: 27911324
  15. Studies indicate S100A8 as the most overexpressed gene, and the cell cycle pathway as the most promising biomarker and therapeutic target for relapsed childhood B-acute lymphoblastic leukemia (B-ALL). PMID: 28183295
  16. Low S100A8 expression is associated with head and neck neoplasms. PMID: 26883112
  17. Report role of fecal calprotectin assay in the diagnosis and management of inflammatory bowel disease. PMID: 28735301
  18. S100A8 and S100A9 aggravate Coxsackievirus B3-induced myocarditis and might serve as therapeutic targets in inflammatory cardiomyopathies. PMID: 29158436
  19. Data suggest that fecal calprotectin may be a potential biomarker to identify patients with ankylosing spondylitis (AS) at risk of developing inflammatory bowel disease (IBD). PMID: 28148281
  20. Elevated S100A8 and S100A9 gene expression in SP-infected HMEECs and in the middle ear mucosa of OM, minor co-localized with neutrophil markers suggests that middle ear epithelial cell secretion of S100A8 and S100A9 may play a role in the pathogenesis of recurrent and chronic OM PMID: 28964306
  21. results of this study support an additional role of calprotectin in assessing inflammatory activity in patients with RA PMID: 28832684
  22. Data show that E3 ubiquitin ligase HRD1 (HRD1) decreased the protein level of S100A8 through ubiquitination. PMID: 28423597
  23. High S100A8 expression is associated with glioblastoma. PMID: 27006175
  24. This study implicates S100A8 and S100A9 as important mediators of tumor cell aggressiveness, and highlights the therapeutic potential of S100A8 and S100A9 for interference of metastasis. PMID: 27086923
  25. Data indicate a statistical correlation between fecal calprotectin (FC) and gastrointestinal graft-versus-host disease (GvHD). PMID: 28293713
  26. Perinatal alarmins S100A8 and S100A9 specifically altered MyD88-dependent proinflammatory gene programs. S100 programming prevented hyperinflammatory responses without impairing pathogen defense. TRIF-adaptor-dependent regulatory genes remained unaffected by perinatal S100 programming and responded strongly to lipopolysaccharide, but were barely expressed. PMID: 28459433
  27. Expression of S100A8, S100A9 and S100A12 is modulated by eicosapentaenoic acid and docosahexaenoic acid during Inflammation in adipose tissue and mononuclear cells. PMID: 28125622
  28. High S100A8 expression is associated with lung metastasis in malignant melanoma. PMID: 27151304
  29. Data show that the standardized nerve growth factor (NGF) concentration was negatively correlated with continuous pain, neuropathic pain and total score, and the standardized S100 proteins S100A8/A9 concentration was positively correlated with present pain intensity and continuous pain. PMID: 27936243
  30. S100A8 and S100A9 proteins in concentrations secreted by CD34(-)/CD31(+) circulating angiogenic cells (CACs) with impaired function reduce endothelial cell capillary-like network formation. These effects appear to be mediated by Toll-like receptor 4 and are absent with S100A8 and S100A9 in concentrations secreted by healthy CD34(-)/CD31(+) CACs. PMID: 27793853
  31. MRP8 elevated serum levels in patients with Behcet's disease indicate MRP8 role in the pathogenetic mechanisms of Behcet's disease. PMID: 25471894
  32. High baseline serum MRP8/14 levels are associated with lower survival in Chinese peritoneal dialysis patients. PMID: 22699162
  33. In acute coronary syndromes, MRP8 and MRP8/14 complex are specific ligands of TLR4, which induce the release of TNFalpha and probably other pro-inflammatory agents from monocytes PMID: 21782178
  34. study revealed a novel role of MRP8/14 in the autophagy-mediated elimination of intracellular BCG by promoting reactive oxygen species generation PMID: 25312864
  35. MRP8 has a crucial role in stimulating IL-6 expression by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 23619188
  36. decreased pretreatment levels of myeloid-related protein-8/14 and C-reactive protein may have a role in poor adherence to treatment with tumor necrosis factor inhibitors in juvenile idiopathic arthritis PMID: 27562034
  37. MRP8/14 can activate cells by binding to TLR4, leading to the release of proinflammatory cytokines. These mediators can lead to increased disease activity in enthesitis-related arthritis. PMID: 24231443
  38. Fibronectin adhesive capacity and integrin expression of monocytes of type 1 and type 2 diabetic patients is related to the subjects' serum levels of MRP-8. PMID: 15277376
  39. Excessive release of cytotoxic MRP8/MRP14 by activated phagocytes might therefore present an important molecular pathomechanism contributing to endothelial damage during vasculitis and other inflammatory diseases PMID: 17095618
  40. MRP8 expression is related to the pathological stage of laryngeal squamous cell carcinoma. PMID: 22256739
  41. MRP8/14 in ankylosing spondylitis is associated with peripheral arthritis and active disease PMID: 27738838
  42. Circulating MRP-8/14 is associated with TX-dependent platelet activation in ACS, even during low-dose aspirin treatment, suggesting a contribution of residual TX to MRP-8/14 shedding, which may further amplify platelet activation. PMID: 25037196
  43. Phosphorylation inhibits tubulin polymerization in microtubules. PMID: 15331440
  44. Data suggest that tissue infiltrating macrophages secreting MRP8/14 may contribute to myositis, by driving the local production of cytokines directly from muscle. PMID: 24286299
  45. calprotectin induces IL-6 and MCP-1 production in Human Gingival Fibroblasts via TLR4 signaling that involves MAPK and NF-kappaB, resulting in the progression of periodontitis. PMID: 27925202
  46. Findings suggest that S100A8/A9 may be involved in the inflammatory response with induction of proinflammatory cytokines and may serve as a clinicopathological marker for disease activity in AOSD. PMID: 27537874
  47. Peripheral blood levels of S100A8 and TRAF6 in SAE patients were elevated and might be related to the severity of SAE and predict the outcome of SAE. PMID: 27411454
  48. Low S100A8/A9 levels may contribute to poor wound healing in colonized chronic wounds with striking difference between diabetic foot ulcers and venous leg ulcers. PMID: 27084691
  49. Suggest that, in individuals with lichen planus, S100A8 may exert distinct immunomodulatory and cytotoxicity functions. PMID: 26632637
  50. Serum calprotectin was significantly higher in rheumatoid arthritis patients than controls, and was correlated with disease activity. It was higher in seropositive than in seronegative patients. PMID: 26767827

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Peripheral membrane protein. Note=Predominantly localized in the cytoplasm. Upon elevation of the intracellular calcium level, translocated from the cytoplasm to the cytoskeleton and the cell membrane. Upon neutrophil activation or endothelial adhesion of monocytes, is secreted via a microtubule-mediated, alternative pathway.
Protein Families
S-100 family
Tissue Specificity
Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutrophils and monocytes
Database Links

HGNC: 10498

OMIM: 123885

KEGG: hsa:6279

STRING: 9606.ENSP00000357721

UniGene: Hs.416073

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1