Recombinant Human Protein-lysine 6-oxidase (LOX)

In Stock
Code CSB-BP013038HU
MSDS
Size $352
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
LOX
Uniprot No.
Research Area
Signal Transduction
Alternative Names
lox; LYOX; LYOX_HUMAN; Lysyl oxidase; MGC105112; Protein lysine 6 oxidase; Protein-lysine 6-oxidase
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
169-417aa
Target Protein Sequence
DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
73.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The plasmid vector incorporates the gene encoding the Human LOX protein (169-417aa), generating recombinant plasmid, which is then introduced into baculovirus cells. Selection of positive baculovirus cells is based on their capacity to withstand a particular antibiotic. Subsequently, the baculovirus cells containing the recombinant plasmid are cultivated under conditions that facilitate the expression of the Human LOX gene. The protein carries a N-terminal MBP tag and C-terminal 6xHis tag. Following expression, affinity purification is employed to isolate and purify the recombinant Human LOX protein from the cell lysate. Denaturing SDS-PAGE is used to resolve the resulting recombinant protein, enabling an estimation of its purity, exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
Gene References into Functions
  1. LOX regulates EGFR cell surface retention to drive tumour progression. PMID: 28416796
  2. The Epithelial-mesenchymal transition (EMT) marker Lox has a differential expression pattern in breast cancer, being significantly overexpressed in triple negative breast cancers. PMID: 29661738
  3. Studies indicate that the mature enzyme plays a key role in modifying the extracellular matrix and as a result has been implicated in playing a role in the formation of cancer "niches" where tumors will develop and eventually metastasize [Review]. PMID: 29309816
  4. Our results indicate the involvement of LOX in the initiation of fibrous capsule formation which ultimately contributes towards the progression of capsular contracture PMID: 29866167
  5. this study has revealed that IL-1beta may contribute to the rupture of fetal membranes by attenuating collagen crosslinking through downregulation of LOX expression in amnion fibroblasts PMID: 28878297
  6. This study focused on the relationship between lysyl oxidase (LOX), LOX-like protein 1 (LOXL1), and LOXL2 and pulmonary emphysema pathogenesis. PMID: 28965583
  7. The aim was to examine if the serum concentrations of elastin-related proteins correlate to signs of cardiovascular diseases in patients with Diabetes mellitus type 2. PMID: 28715234
  8. LOX role in cancer stromal cells activation and promotion of gastric cancer progression PMID: 29343955
  9. an association of LOX gene polymorphism (G473A) on diabetes and DFU patients PMID: 28522400
  10. LOX expression was mildly but significantly upregulated in CD34+-derived primary myelofibrosis megakaryocytes and platelets compared with controls. These megakaryocytes showed a greater tendency to adhere and spread to monomeric collagen, and this was inhibited by the LOX-specific inhibitor BAPN. PMID: 28592432
  11. Data suggest that a missense mutation in lysyl oxidase (LOX) is associated with aortic disease. PMID: 27432961
  12. Our findings suggest that LOX has a role in cancer cell mitosis PMID: 27296552
  13. Our findings provide new evidence that LOX regulates SNAI2 expression and that SNAI2-mediated TIMP4 secretion plays a role in cancer progression. PMID: 27029493
  14. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. PMID: 28106301
  15. LOX is a prognostic factor for poor progression free survival in patients with ER- breast cancer. LOX overexpression was positively correlated with resistance to radiation and drug therapy. PMID: 27147578
  16. This preliminary study indicated that LOX gene polymorphisms, such as rs2303656, rs3900446, and rs763497, may play crucial roles in intracranial aneurysm formation in the Korean population. PMID: 28792146
  17. Results show that CTGF mediates the GDF8-induced up-regulation of LOX expression and increases in LOX activity in human granulosa cells. PMID: 27392496
  18. The LOXL1 SNPs, rs1048661 and rs3825942, are associated with PXF in the South Indian population correlating with lowered LOX activity in the aqueous humor. The increased level of total TGF-beta in the aqueous humor of PXF cases is possibly associated with LOX regulation which needs further investigation. PMID: 27116380
  19. These findings suggest that LOX induces an age-dependent disturbance of diastolic function and aggravates Ang II-induced hypertrophy, which provides novel insights into the role of LOX in cardiac performance. PMID: 28522596
  20. LOX, a hypoxia-responsive gene that encodes lysyl oxidase, is activated by HIF-2-alpha more than HIF-1. Two new hypoxia response elements identified in the LOX promoter mediate most HIF responsiveness. PMID: 28624448
  21. our findings show that LOX supports colorectal cancer cell dissemination in the bone marrow PMID: 27742687
  22. LOX G473A polymorphism apparently elevated human sensitivity to cigarette smoking carcinogens for eliciting cancers in the lung and colon only. Thus, LOX G473A polymorphism positively correlates with carcinogenesis and it may be used as an ideal intrinsic biomarker for prediction or diagnosis of carcinogenesis in humans. PMID: 27367711
  23. increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranes PMID: 27533889
  24. endogenous LOX is overexpressed in clear cell renal cell carcinoma, is involved in a positive-regulative loop with HIF-1alpha, and has a major action on clear cell renal cell carcinoma progression through cellular adhesion, migration, and collagen matrix stiffness increment PMID: 27449199
  25. colorectal carcinoma perilesional extracellular matrix has increased content of lysyl oxidase PMID: 26940881
  26. LOX affects the epithelial-mesenchymal transition of gastric cancer cells in hypoxic conditions. PMID: 26100130
  27. High expression of LOX is associated with nasopharyngeal carcinoma. PMID: 26882568
  28. Here we show that orthotopic implantation of rat prostate AT-1 tumour cells increased LOX and LOXLs mRNA expressions in the tumour and in the surrounding non-malignant prostate tissue PMID: 26804196
  29. Results show that LOX expression regulation by FoxF1 increases invasiveness of breast cancer cells. PMID: 26908052
  30. LOX gene expression was approximately 2.5-fold higher in fetal membranes from preterm prelabor rupture of membranes (pPROM) compared to preterm and term birth. PMID: 26011922
  31. The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites. PMID: 26893379
  32. Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase. PMID: 26437801
  33. Our study demonstrated that the LOX rs1800449 genotypes (AA and GA + AA) and allele (A) appears to confer risk for susceptibility to keratoconus. PMID: 24502826
  34. Individuals with LOX variants had fusiform enlargement of the aortic root and ascending thoracic aorta, leading to ascending aortic dissections. PMID: 26838787
  35. two LOX variants, rs2956540 and rs10519694, may affect individual susceptibility to keratoconus PMID: 26713757
  36. LOX expression at the mRNA and protein level, and enzymatic activity were remarkably upregulated in the hypoxic A549 cells, compared with normoxic A549 cells. PMID: 26515140
  37. Aortic tissue from Marfan syndrome patients and display enhanced expression of the members of the LOX family, LOX and LOX-like 1. PMID: 25988230
  38. Evidence for association was found for both of the tested loci.It was strongest for rs3735520:G>A near HGF with A allele being a risk factor and rs2956540:G>C within LOX with C allele having a protective effect PMID: 25735481
  39. Using principal component analysis (PCA), the authors identified a LOX/hypoxia signature associated with poor patient survival in resectable pancreatic ductal adenocarcinoma patients. PMID: 26077591
  40. Serum sLOX-1 levels were independently correlated with the presence and severity of OSA. PMID: 25825846
  41. hypoxic stress of obstructive sleep apnea may increase circulating lysyl oxidase (LOX) levels; LOX may serve as a biomarker of liver fibrosis in patients with severe obesity and nonalcoholic fatty liver disease PMID: 26085300
  42. these results corroborate the role of LOX in the migration, invasion and angiogenesis of astrocytomas. Furthermore, LOX expression is influenced by IDH1 mutational status. PMID: 25790191
  43. LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality. PMID: 26048020
  44. High lysyl oxidase expression level in amnion is associated with higher birth weight of Tibetan newborns. PMID: 25501874
  45. High LOX expression was associated with a poor disease-free and metastasis-free survival in ER negative but not ER positive breast cancer patients. PMID: 25141126
  46. Study demonstrated that reactive oxygen species promote the migration and metastatic growth of ovarian cancer cells via upregulation of HIF-1a and LOX and E-cadherin repression. PMID: 25174950
  47. LOX activity is required in the control of collagen fibril architecture. PMID: 25979340
  48. Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity. PMID: 25593510
  49. LOX may play a role in the metastasis of non-small cell lung cancer by promoting MMP2/MMP9 expression. LOX expression is an independent prognostic factor for survival in NSCLC. PMID: 25337249
  50. LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions PMID: 26017313

Show More

Hide All

Involvement in disease
Aortic aneurysm, familial thoracic 10 (AAT10)
Subcellular Location
Secreted. Secreted, extracellular space.
Protein Families
Lysyl oxidase family
Tissue Specificity
Heart, placenta, skeletal muscle, kidney, lung and pancreas.
Database Links

HGNC: 6664

OMIM: 153455

KEGG: hsa:4015

STRING: 9606.ENSP00000231004

UniGene: Hs.102267

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*