Recombinant Human Protein-lysine 6-oxidase(LOX)

In Stock
Code CSB-EP013038HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P28300
Lead Time 3-7 business days
Relevance Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Research Area Cardiovascular
Source E.coli
Gene Names LOX
Protein Names Lysyl oxidase
Expression Region 169-417aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 49.0 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin
Involvement in disease Aortic aneurysm, familial thoracic 10 (AAT10)
Subcellular Location Secreted, Secreted, extracellular space
Protein Families Lysyl oxidase family
Tissue Specificity Heart, placenta, skeletal muscle, kidney, lung and pancreas.
Database Links

HGNC: 6664

OMIM: 153455

KEGG: hsa:4015

STRING: 9606.ENSP00000231004

UniGene: Hs.102267

Related Products

LOX Antibodies

LOX Antibodies for Homo sapiens (Human)

LOX Antibodies for Human

LOX Proteins

LOX Proteins for Homo sapiens (Human)

LOX ELISA Kit

LOX ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.