Recombinant Human Protein-lysine 6-oxidase(LOX)

In Stock
Code CSB-EP013038HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names LOX
Uniprot No. P28300
Research Area Cardiovascular
Alternative Names lox; LYOX; LYOX_HUMAN; Lysyl oxidase; MGC105112; Protein lysine 6 oxidase; Protein-lysine 6-oxidase
Species Homo sapiens (Human)
Source E.coli
Expression Region 169-417aa
Target Protein Sequence DDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 49.0 kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin
Gene References into Functions
  1. LOX regulates EGFR cell surface retention to drive tumour progression. PMID: 28416796
  2. The Epithelial-mesenchymal transition (EMT) marker Lox has a differential expression pattern in breast cancer, being significantly overexpressed in triple negative breast cancers. PMID: 29661738
  3. Studies indicate that the mature enzyme plays a key role in modifying the extracellular matrix and as a result has been implicated in playing a role in the formation of cancer "niches" where tumors will develop and eventually metastasize [Review]. PMID: 29309816
  4. Our results indicate the involvement of LOX in the initiation of fibrous capsule formation which ultimately contributes towards the progression of capsular contracture PMID: 29866167
  5. this study has revealed that IL-1beta may contribute to the rupture of fetal membranes by attenuating collagen crosslinking through downregulation of LOX expression in amnion fibroblasts PMID: 28878297
  6. This study focused on the relationship between lysyl oxidase (LOX), LOX-like protein 1 (LOXL1), and LOXL2 and pulmonary emphysema pathogenesis. PMID: 28965583
  7. The aim was to examine if the serum concentrations of elastin-related proteins correlate to signs of cardiovascular diseases in patients with Diabetes mellitus type 2. PMID: 28715234
  8. LOX role in cancer stromal cells activation and promotion of gastric cancer progression PMID: 29343955
  9. an association of LOX gene polymorphism (G473A) on diabetes and DFU patients PMID: 28522400
  10. LOX expression was mildly but significantly upregulated in CD34+-derived primary myelofibrosis megakaryocytes and platelets compared with controls. These megakaryocytes showed a greater tendency to adhere and spread to monomeric collagen, and this was inhibited by the LOX-specific inhibitor BAPN. PMID: 28592432
  11. Data suggest that a missense mutation in lysyl oxidase (LOX) is associated with aortic disease. PMID: 27432961
  12. Our findings suggest that LOX has a role in cancer cell mitosis PMID: 27296552
  13. Our findings provide new evidence that LOX regulates SNAI2 expression and that SNAI2-mediated TIMP4 secretion plays a role in cancer progression. PMID: 27029493
  14. UXT Is a LOX-PP Interacting Protein That Modulates Estrogen Receptor Alpha Activity in Breast Cancer Cells. PMID: 28106301
  15. LOX is a prognostic factor for poor progression free survival in patients with ER- breast cancer. LOX overexpression was positively correlated with resistance to radiation and drug therapy. PMID: 27147578
  16. This preliminary study indicated that LOX gene polymorphisms, such as rs2303656, rs3900446, and rs763497, may play crucial roles in intracranial aneurysm formation in the Korean population. PMID: 28792146
  17. Results show that CTGF mediates the GDF8-induced up-regulation of LOX expression and increases in LOX activity in human granulosa cells. PMID: 27392496
  18. The LOXL1 SNPs, rs1048661 and rs3825942, are associated with PXF in the South Indian population correlating with lowered LOX activity in the aqueous humor. The increased level of total TGF-beta in the aqueous humor of PXF cases is possibly associated with LOX regulation which needs further investigation. PMID: 27116380
  19. These findings suggest that LOX induces an age-dependent disturbance of diastolic function and aggravates Ang II-induced hypertrophy, which provides novel insights into the role of LOX in cardiac performance. PMID: 28522596
  20. LOX, a hypoxia-responsive gene that encodes lysyl oxidase, is activated by HIF-2-alpha more than HIF-1. Two new hypoxia response elements identified in the LOX promoter mediate most HIF responsiveness. PMID: 28624448
  21. our findings show that LOX supports colorectal cancer cell dissemination in the bone marrow PMID: 27742687
  22. LOX G473A polymorphism apparently elevated human sensitivity to cigarette smoking carcinogens for eliciting cancers in the lung and colon only. Thus, LOX G473A polymorphism positively correlates with carcinogenesis and it may be used as an ideal intrinsic biomarker for prediction or diagnosis of carcinogenesis in humans. PMID: 27367711
  23. increased cortisol and 11beta-HSD1 abundance and decreased LOX abundance were observed in human amnion tissue after the labor-initiated spontaneous rupture of membranes PMID: 27533889
  24. endogenous LOX is overexpressed in clear cell renal cell carcinoma, is involved in a positive-regulative loop with HIF-1alpha, and has a major action on clear cell renal cell carcinoma progression through cellular adhesion, migration, and collagen matrix stiffness increment PMID: 27449199
  25. colorectal carcinoma perilesional extracellular matrix has increased content of lysyl oxidase PMID: 26940881
  26. LOX affects the epithelial-mesenchymal transition of gastric cancer cells in hypoxic conditions. PMID: 26100130
  27. High expression of LOX is associated with nasopharyngeal carcinoma. PMID: 26882568
  28. Here we show that orthotopic implantation of rat prostate AT-1 tumour cells increased LOX and LOXLs mRNA expressions in the tumour and in the surrounding non-malignant prostate tissue PMID: 26804196
  29. Results show that LOX expression regulation by FoxF1 increases invasiveness of breast cancer cells. PMID: 26908052
  30. LOX gene expression was approximately 2.5-fold higher in fetal membranes from preterm prelabor rupture of membranes (pPROM) compared to preterm and term birth. PMID: 26011922
  31. The data suggest a fibromodulin-modulated collagen cross-linking mechanism where fibromodulin binds to a specific part of the collagen domain and also forms a complex with lysyl oxidase, targeting the enzyme toward specific cross-linking sites. PMID: 26893379
  32. Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase. PMID: 26437801
  33. Our study demonstrated that the LOX rs1800449 genotypes (AA and GA + AA) and allele (A) appears to confer risk for susceptibility to keratoconus. PMID: 24502826
  34. Individuals with LOX variants had fusiform enlargement of the aortic root and ascending thoracic aorta, leading to ascending aortic dissections. PMID: 26838787
  35. two LOX variants, rs2956540 and rs10519694, may affect individual susceptibility to keratoconus PMID: 26713757
  36. LOX expression at the mRNA and protein level, and enzymatic activity were remarkably upregulated in the hypoxic A549 cells, compared with normoxic A549 cells. PMID: 26515140
  37. Aortic tissue from Marfan syndrome patients and display enhanced expression of the members of the LOX family, LOX and LOX-like 1. PMID: 25988230
  38. Evidence for association was found for both of the tested loci.It was strongest for rs3735520:G>A near HGF with A allele being a risk factor and rs2956540:G>C within LOX with C allele having a protective effect PMID: 25735481
  39. Using principal component analysis (PCA), the authors identified a LOX/hypoxia signature associated with poor patient survival in resectable pancreatic ductal adenocarcinoma patients. PMID: 26077591
  40. Serum sLOX-1 levels were independently correlated with the presence and severity of OSA. PMID: 25825846
  41. hypoxic stress of obstructive sleep apnea may increase circulating lysyl oxidase (LOX) levels; LOX may serve as a biomarker of liver fibrosis in patients with severe obesity and nonalcoholic fatty liver disease PMID: 26085300
  42. these results corroborate the role of LOX in the migration, invasion and angiogenesis of astrocytomas. Furthermore, LOX expression is influenced by IDH1 mutational status. PMID: 25790191
  43. LOX gene expression is a predictive factor in hepatocellular liver cancer prognosis and mortality. PMID: 26048020
  44. High lysyl oxidase expression level in amnion is associated with higher birth weight of Tibetan newborns. PMID: 25501874
  45. High LOX expression was associated with a poor disease-free and metastasis-free survival in ER negative but not ER positive breast cancer patients. PMID: 25141126
  46. Study demonstrated that reactive oxygen species promote the migration and metastatic growth of ovarian cancer cells via upregulation of HIF-1a and LOX and E-cadherin repression. PMID: 25174950
  47. LOX activity is required in the control of collagen fibril architecture. PMID: 25979340
  48. Attenuation of lysyl oxidase and collagen gene expression in keratoconus patient corneal epithelium corresponds to disease severity. PMID: 25593510
  49. LOX may play a role in the metastasis of non-small cell lung cancer by promoting MMP2/MMP9 expression. LOX expression is an independent prognostic factor for survival in NSCLC. PMID: 25337249
  50. LOX is a novel regulator of NFATc1-driven osteoclastogenesis, independent of RANK ligand, which disrupts normal bone homeostasis leading to the formation of focal pre-metastatic lesions PMID: 26017313
  51. The effect of LOX G473A polymorphism on cancer risk among Asians, was investigated. PMID: 25112403
  52. LOX with CEA, CA724, CA199, and CA125 could increase the sensitivity of predicting lymph nodes metastasis and peritoneal metastasis in gastric cancer PMID: 25060181
  53. This case-control study provided evidence that LOX polymorphisms were associated with increased susceptibility to cervical cancer, in which rs2278226 could increase serum levels of LOX in cervical cancer patients. PMID: 24945327
  54. lysyl oxidase propeptide inhibits hepatocellular carcinoma cell proliferation and induces its apoptosis PMID: 24573150
  55. LOX displays tumor suppressor activities PMID: 23750284
  56. LOX, LOXL1 and LOXL2 are downstream PPARgamma targets and that LOX activity is a negative regulator of trophoblastic cell invasion PMID: 24265769
  57. RKIP, LOX and SDC2 are coordinately regulated and collectively encompass a prognostic signature for metastasis-free survival in ER-negative breast cancer patients PMID: 23975428
  58. miR-29b down-regulates HSP47 and LOX expression. PMID: 24650661
  59. This study could not observe any significant role of LOX polymorphisms in influencing intracranial aneurysm. PMID: 24065528
  60. LOX-PP interacts with CIN85 via a novel SH3-binding motif and this association reduces CIN85-promoted invasion by breast cancer cells. PMID: 24167568
  61. Loss of Protein-Lysine 6-Oxidase is associated with osteosarcoma. PMID: 23970168
  62. This study is the first to demonstrate high serum LOX levels in SSc patients that correlate specifically with skin fibrosis. These correlations suggest that LOX levels may serve as a novel biomarker of fibrosis. PMID: 24574233
  63. Polymorphism in LOX gene was associated with increased susceptibility to glioma and could be used as prognostic factor for this malignancy. PMID: 23758270
  64. These results indicated that LOX polymorphisms were associated with increased susceptibility to rhegmatogenous retinal detachment and Proliferative vitreoretinopathy and suggest a potential correlation between LOX and ocular inflammation. PMID: 23413043
  65. lysyl oxidase activity participates in primary tumor growth by directly impacting the senescence stability. PMID: 24113189
  66. Bisphenol A exposure interacts with the -22 G/C polymorphism of the LOX gene to increase the risk of osteosarcoma. PMID: 23886186
  67. An excess of osteopontin is associated with increased LOX and insoluble collagen, as well as with left ventricular stiffness and systolic dysfunction in patients with hypertensive heart failure. PMID: 23619422
  68. Pterostilbene displayed significant potency to reduce LOX-mediated activity in E40 cells when combined with curcumin. Colony formation of E40 cells in soft agar was reduced by both genetic depletion of LOX and by chemical inhibitors of LOX expression. PMID: 23560895
  69. Collectively, our study demonstrates that the hypoxia-HIF-1a, LOX-FAK/AKT pathway regulates the migration and invasion of epithelial ovarian cancer cells PMID: 23545606
  70. Studies indicate that mesenchymal stem cells (MSC)-derived hyaluronan (HA) was sufficient and necessary to induce lysyl oxidase (LOX) and Twist in the cancer cells. PMID: 23530115
  71. TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4). PMID: 23357697
  72. conclude that the ECM modulating enzyme LOX is associated with amyloid-beta pathology in Alzheimer's disease and hereditary cerebral hemorrhage with amyloidosis--Dutch type. PMID: 23267843
  73. Data suggest that all members of LOX gene family (lysyl-oxidase [LOX]; lysyl oxidase-like proteins [LOXL1, LOXL2, LOXL3]) are over-expressed in bone marrow in primary myelofibrosis; LOX gene family is not detectable in normal bone marrow. PMID: 23494965
  74. Collectively, these findings suggest LOX enhances hypoxia-induced invasion and migration in cervical cancer cells mediated by the epithelial-mesenchymal transition. PMID: 23165370
  75. LOX protein was positively correlated with MMP-2 and MMP-9. PMID: 22994786
  76. the LOX activity, which is composite of all the isoforms, was reduced under high glucose conditions, there was a differential mRNA expression with increased LOX and LOXL1 and decreased LOXL2 expression. PMID: 22966818
  77. Suggest a causal relationship between LOX downregulation and aortic stiffening in obesity. PMID: 23413430
  78. The inhibition of LOX resulted in a decrease in invasion area, but only very mildly in invasion depth of oral carcinoma. PMID: 23262025
  79. we show that LOX is clinically correlated with VEGF expression and blood vessel formation in 515 colorectal cancer patient samples. PMID: 23188504
  80. LOX, MMP-2, and MMP-9 may have a synergistic role in promoting invasion and metastasis of breast cancer. PMID: 22883193
  81. The data suggest that the G473A polymorphism of the LOX gene is associated with increased susceptibility to ovarian cancer. PMID: 22533780
  82. LOX 473 G/A polymorphism is associated with increased risk of nonsmall cell lung cancer. PMID: 22948781
  83. The G473A polymorphism of LOX gene could be a new risk factor for ischemic stroke. PMID: 22722997
  84. Lysyl oxidase-mediated excessive collagen cross-linking facilitates the increase in left ventricular stiffness with the resulting elevation of filling pressures in hypertensive patients. PMID: 22824984
  85. Studies indicate the contribution of megakaryocytes (MKs) to the progression of myelofibrosis with the newly identified role of lysyl oxidase (LOX). PMID: 22767499
  86. Expressions of LOX and MMP-2 in gastric cancer tissues are significantly higher than that in pericancerous tissues, and are also higher in gastric cancer with lymph node metastasis. PMID: 21575462
  87. A novel polymorphism in the LOX gene, G473A (rs1800449), was identified. Frequencies of LOX 473 AA genotype and A allele were significantly higher in patients with coronary artery disease than in controls. PMID: 21612403
  88. The results suggest that decreased expression of elastin and LOX and increased expression of elafin in the cardinal ligaments may contribute to pelvic organ prolapse. PMID: 19087518
  89. G473A polymorphism of the lysyl oxidase gene may be closely associated with susceptibility to the development and differentiation of gastric cancer in South Korean patients. PMID: 21995629
  90. LOX is a potential mediator that couples mechanotransduction to oncogenic signaling by TGF-beta1 and measures capable of inactivating LOX function may prove effective in diminishing breast cancer progression stimulated by TGF-beta1. PMID: 21532881
  91. Human lysyl oxidase gene does not confer increased genotypic risk for adolescent idiopathic scoliosis. PMID: 21740577
  92. Both Smad and non-Smad signaling pathways are involved in TGFbeta-mediated LOX induction, suggesting complex regulation of these important extracellular matrix cross-linking enzymes. PMID: 21546528
  93. the interaction of LOX-PP with Hsp70 and c-Raf inhibits a critical intermediate in Ras-induced MEK signaling and plays an important role in the function of this tumor suppressor PMID: 21536655
  94. Analysis revealed that left atrial appendage of atrial fibrillation patients are characterized by increased lysyl oxidase (LOX) mRNA (218 +/- 42%) and protein (253 +/- 11%) expression. PMID: 21215756
  95. Review of down-regulation of lysyl oxidase expression in lung cells by components of cigarette smoke, indicating lysyl oxidase as a critical intra- and extracellular target for cigarette smoke pathogenesis in the lung. PMID: 21318022
  96. Data show that CA9, GLUT1 and LOX mRNA levels were equally and strongly correlated to hypoxic extent in FaDudd, and the same was observed for CA9 and GLUT1, but not LOX, in SCCVII tumors. PMID: 21306648
  97. these findings provide compelling evidence that LOX and HIF-1 act in synergy to foster tumor formation PMID: 21239473
  98. LOX showed an important role in CRC cell proliferation and metastasis and was dependent on the activation of SRC. These results have the potential to identify patients with high SRC activity, who may benefit from dasatinib treatment. PMID: 21282564
  99. A finely regulated expression of LOX is necessary for normal keratinocyte differentiation and thus for maintenance of epidermal homeostasis. PMID: 20812961
  100. requirement of the LOX-PrePeptide for pro-LOX exit from the ER and the influence of LOX-PP glycosylation on LOX enzyme activity. PMID: 20717923

Show More

Hide All

Involvement in disease Aortic aneurysm, familial thoracic 10 (AAT10)
Subcellular Location Secreted, Secreted, extracellular space
Protein Families Lysyl oxidase family
Tissue Specificity Heart, placenta, skeletal muscle, kidney, lung and pancreas.
Database Links

HGNC: 6664

OMIM: 153455

KEGG: hsa:4015

STRING: 9606.ENSP00000231004

UniGene: Hs.102267

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1