Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Code CSB-EP880070HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names PPP1R1B
Uniprot No. Q9UD71
Research Area Neuroscience
Alternative Names DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-168aa
Target Protein Sequence MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 45.7kDa
Protein Length Full Length of Isoform 2
Tag Info N-terminal GST-tagged
Buffer Tris-based buffer,50% glycerol
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Target Data

Function Inhibitor of protein-phosphatase 1.
Subcellular Location Cytoplasm
Protein Families Protein phosphatase inhibitor 1 family
Database Links

HGNC: 9287

OMIM: 604399

KEGG: hsa:84152

STRING: 9606.ENSP00000254079

UniGene: Hs.286192

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.