Recombinant Human Resistin-like beta (RETNLB)

Code CSB-YP860653HU
Abbreviation Recombinant Human RETNLB protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RETNLB
Uniprot No.
Research Area
Signal Transduction
Alternative Names
C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2; CCGR; Colon and small intestine specific cysteine rich protein; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma related gene protein; Colon carcinoma-related gene protein; Cysteine rich secreted A12 alpha like protein 1; Cysteine rich secreted protein A12 alpha like 1; Cysteine rich secreted protein FIZZ2; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; Found in inflammatory zone 1; HXCP2; RELM beta; RELMb; RELMbeta; Resistin like beta; Resistin like protein beta; Resistin-like beta; RETNB_HUMAN; RETNL2; Retnlb; XCP2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
24-111aa
Target Protein Sequence
QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable hormone.
Gene References into Functions
  1. The human mesangial cells with up-regulated and down-regulated expression of RELM-beta increased or decreased significantly at 2-3 days. PMID: 28801998
  2. RELMbeta-overexpression can facilitate invasion and migration of gastric carcinoma cells. PMID: 27001185
  3. RELMbeta levels were increased in Abdominal aortic aneurysm patients in the serum and in the aortic tissue. Increased RELMbeta levels may be involved in the pathogenesis of AAA formation and progress. PMID: 25479529
  4. The data demonstrated that RELM-a is a promising novel biomarker of angiogenesis in patients with gastric cancer. PMID: 25937206
  5. elevated RELM-beta expression in asthmatic airways contributes to airways remodelling at least partly by increasing fibroblast proliferation and differentiation with resulting deposition of extracellular matrix proteins. PMID: 25545115
  6. It is concluded that proper exercise training prevents up-regulation of FIZZ1/RELMalpha induced by cigarette smoking, which may be involved in the mechanism of proper exercise training modulating airway hyperresponsiveness. PMID: 23392702
  7. RELMbeta is abundantly expressed in foam cells within plaques and contributes to atherosclerosis development via lipid accumulation and inflammatory facilitation. PMID: 23702657
  8. Epithelial cell derived Fizz1 transgene is sufficient to increase bone-marrow derived dendritic cells in the lungs. PMID: 22726462
  9. RELM-beta may play an important role not only in animal models of airway remodelling, but also in human airway pathology. PMID: 22758223
  10. RELM-beta has the potential to contribute to airway remodelling in diseases such as asthma by acting on epithelial cells to increase proliferation, mucin and growth factor production, at least partly via ERK/MAPK-PI3K/Akt signalling pathways. PMID: 21828035
  11. Data show that over-expression of RELMbeta abolishes the invasion, metastasis and angiogenesis of gastric cancer cells in vitro. PMID: 22371635
  12. High RELMbeta is associated with colorectal cancer. PMID: 21094111
  13. FIZZ2 is highly induced in lungs of human patients with idiopathic pulmonary fibrosis. PMID: 21602491
  14. Gastric cncer patients showing positive RELMbeta expression had a significantly longer overall survival than those with negative expression (P = 0.001). PMID: 19967544
  15. High levels of RELMbeta can be detected in the stool of mice and humans, where it exists as a homodimer under nonreducing conditions. PMID: 14598255
  16. Of the 80 colon cancer patients studied, 65 (81.25%) tested positive for RELM beta, mainly in the cytoplasm of colon mucosa. PMID: 18594973
  17. Results suggest that RELM-beta may be involved in the development of scleroderma-associated pulmonary hypertension. PMID: 19251945
  18. Supernatant from COS cells transfected with the CCRG (RETNLB) expression vector stimulated proliferation of colon cancer cells, which supports the growth factor nature of the RETNLB gene. PMID: 12224133

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Resistin/FIZZ family
Tissue Specificity
Expressed only in the gastrointestinal tract, particularly the colon.
Database Links

HGNC: 20388

OMIM: 605645

KEGG: hsa:84666

STRING: 9606.ENSP00000295755

UniGene: Hs.307047

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*