Recombinant Human Sclerostin (SOST), Biotinylated

Promotion
Code CSB-MP858415HU-B
Abbreviation Recombinant Human SOST protein, Biotinylated
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than ≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-213aa
Target Protein Sequence
QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
Gene References into Functions
  1. Sclerostin is degraded by cathepsin K in vitro. Cathepsin K degradation of sclerostin is affected by hypoxia. PMID: 29859187
  2. Study found that sclerostin concentrations were not significantly higher in patients with bone metastases compared to non-metastatic prostate cancer (PC) but they were significantly higher in patients with CRPC. Sclerostin levels were significantly higher in patients with advanced disease and increased bone turnover due to a compensatory response to the increased number of osteoblasts. PMID: 30116403
  3. Patients with Latent autoimmune diabetes in Adults (LADA) presented lower bone resorption than did controls, similar to patients with T2 diabetes (T2D). Sclerostin is increased in T2D but not in LADA, suggesting possible roles on bone metabolism in T2D only. PMID: 29506222
  4. Higher Sclerostin/SOST expression is associated with lower percentage of circulatory blasts and better prognosis in patients with myelofibrosis. PMID: 29532161
  5. Sclerosteosis is caused by loss-of-function mutations in the SOST gene which encodes a secreted glycoprotein, sclerostin--{REVIEW} PMID: 29080811
  6. Serum sclerostin level was not an independent predictor of mortality in Maintenance Hemodialysis Patients PMID: 29940587
  7. these results suggest a possible role of sclerostin in the identification of ankylosing spondylitis patients PMID: 29854850
  8. important role for SOST SNP rs1877632 and VDR SNPs rs10735810 and rs731236 in the pathophysiology of stress fracture PMID: 29129460
  9. Sclerostin increased after exercise in comparison to baseline (mean +/- SEM: 410 +/- 27 vs. 290 +/- 19 pg/mL; p < 0.001) corresponding to an increase of +44.3 +/-5.5% PMID: 28374174
  10. serum sclerostin levels correlated positively with carotid intima-media thickness and inversely with the augmentation index, a marker of arterial stiffness PMID: 28339088
  11. The difference of serum sclerostin levels in Ankylosing Spondylitis and Rheumatoid Arthritis patients was not significantly different from HC, indicating that the sclerostin may not associate with the development of Ankylosing Spondylitis and Rheumatoid Arthritis. PMID: 28553652
  12. SOST gene silencing promotes the proliferation, invasion, and migration, and inhibits apoptosis of osteosarcoma cells by activating Wnt/beta-catenin signaling pathway PMID: 28246931
  13. No difference was found in the serum sclerostin levels between the hyperthyroidism patients and healthy control. PMID: 29059259
  14. Positivity of RANKL and anti-CCP2 yielded significant risk for progression with negativity for both as reference. No single nucleotide polymorphism encoding TNFSF11 or SOST was associated with increased concentrations of the factors. PMID: 28190118
  15. Osterix and RUNX2 are transcriptional regulators of sclerostin in human bone PMID: 27154028
  16. An association was found between rs851054 of the SOST promoter and the fracture rate during childhood osteogenesis imperfecta. PMID: 27519970
  17. The increased expression of sclerostin in the liver and the association with histologic cholangitis may explain the high serum levels of this protein in patients with primary biliary cirrhosis. PMID: 27019303
  18. SOST silencing promotes the proliferation, invasion and migration, and decreases the apoptosis of human retinoblastoma cells by activating the Wnt/beta-catenin signaling pathway. PMID: 28485721
  19. Sclerostin concentrations in serum significantly decreased and IGF-I significantly increased after 12months of resistance training or JUMP. PMID: 27744012
  20. observed an association between sclerostin levels with fasting insulin levels and homoeostatic model assessment-insulin resistance, but there was no clear association with type 2 diabetes risk. PMID: 28090669
  21. Sclerostin levels in KTR are normal and influenced more by bone turnover than by eGFR. Its involvement with other hormones of mineral homeostasis (FGF23/Klotho and Vitamin D) is part of the sophisticated cross-talk between bone and the kidney PMID: 28558021
  22. Vitamin D receptor agonism by paricalcitol causes a moderate increase in serum sclerostin in CKD patients, and this effect is modified by circulating pentosidine levels. PMID: 28017524
  23. SOST is frequently expressed in skeletal bone- and cartilage-forming tumors. The strong spatial correlation with bone formation and the in vitro expression patterns are in line with the known functions of SOST in nonneoplastic bone, as a feedback inhibitor on osteogenic differentiation. PMID: 27498059
  24. Intermittent compressive stress regulates Notch receptor and target gene expression via the TGF-beta signaling pathway. Notch signaling participates in TGF-beta-induced sclerostin expression in periodontal ligament cells. PMID: 27966788
  25. Dickkopf-1 and sclerostin were never correlated with each other or with bone turnover markers patients with Paget's disease of bone. Sclerostin was positively correlated with age. PMID: 28054306
  26. These data suggest that sclerostin plays an important role in the bone remodeling of tooth movement. PMID: 28081119
  27. SOST is expressed in the aorta and downregulated in human aortic aneurysms and atherosclerosis, possibly because of epigenetic silencing. PMID: 28062506
  28. The level of sclerostin was higher in the female obstructive sleep apnea (OSA) patients than that in female controls. Further, in OSA women with cardiovascular comorbidities, sclerostin was higher than in women without such comorbidities. In men, there were no differences in the serum sclerostin level between the OSA and control subjects, nor was there any relationship with cardiovascular diseases. PMID: 26820731
  29. Knockdown of SOST in MG-63 cells increases osteogenesis and ratio of OPG/RANKL in vitro PMID: 27774939
  30. The findings confirm that the human SOST gene and sclerostin expression can be considered to be directly 1,25-dihydroxyvitamin D-responsive in osteocytes. PMID: 26690786
  31. Sclerostin is an osteocyte marker that is strongly expressed in human woven and lamellar bone and mineralizing chondrocytes PMID: 26896083
  32. similar levels in type 1 diabetes patients and controls; decrease concurrent with adolescent growth spurt PMID: 26094958
  33. Findings indicate that sclerostin expression is closely associated with the degree of joint damage in primary knee osteoarthritis (OA), confirming its involvement in the development of OA. PMID: 27665782
  34. Results suggest that sclerostin may have a role in the development of or the response to abdominal aortic calcification in chronic kidney disease. PMID: 27165564
  35. serum sclerostin levels were lower in nonalcoholic steatohepatitis patients than in controls. PMID: 26056025
  36. The aim of this study was to evaluate the renal handling of sclerostin. PMID: 27214309
  37. chronic TNFalpha (tumor necrosis factor alpha)-dependent arthritis, fibroblast-like synoviocytes constitute a major source of sclerostin and that either the lack of sclerostin or its antibody-mediated inhibition leads to an acceleration of rheumatoid arthritis (RA)-like disease. PMID: 27089204
  38. Sclerostin levels are elevated in CKD patients and are associated with inflammation, vascular lesions, uremia and (potentially) mortality. PMID: 25070604
  39. Our data also demonstrated that vitamin D deficient newborns exhibited lower sclerostin levels than vitamin D sufficient newborns. PMID: 26352089
  40. the first evidence suggesting that LRP4 is responsible for the retention of sclerostin in the bone environment in humans. PMID: 26751728
  41. higher serum sclerostin levels are associated with higher bone mineral density, lower aortic calcification scores, and a better survival rate in hemodialysis patients PMID: 26890570
  42. findings suggest that serum TGF-beta1 level increases during postmenopause and declines in old age. Sclerostin production is inhibited by TGF-beta1 during early postmenopause PMID: 26826396
  43. a cell model of human dermal fibroblasts in order to investigate the functions of sclerostin, is reported. PMID: 26851122
  44. The aims of this study were to evaluate OCN and sclerostin levels in subjects who underwent coronary artery bypass graft (CABG) surgery compared with those in normal controls. PMID: 26576474
  45. two affected siblings who carried a novel nonsense mutation of SOST in a consanguineous family from China, is reported. PMID: 26283468
  46. Sclerostin serum levels are not associated with an adverse metabolic profile during pregnancy in women with GDM and PE PMID: 25753744
  47. Quantitative RT-PCR analysis showed that SOST expression dose-dependently decreased with increasing Wnt signaling, while BMP4 induced SOST expression PMID: 26095393
  48. The correlation of SOST polymorphisms with changes of BMD and bone biomarkers after treatment was analyzed. PMID: 26250343
  49. highly sulfated glycosaminoglycans might control bone homeostasis via interference with sclerostin/LRP5/6 complex formation. PMID: 26232882
  50. Serum sclerostin was associated with serum intact parathyroid hormone in patients undergoing peritoneal dialysis. PMID: 25974190

Show More

Hide All

Involvement in disease
Sclerosteosis 1 (SOST1); Van Buchem disease (VBCH); Craniodiaphyseal dysplasia autosomal dominant (CDD)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Sclerostin family
Tissue Specificity
Widely expressed at low levels with highest levels in bone, cartilage, kidney, liver, bone marrow and primary osteoblasts differentiated for 21 days. Detected in the subendothelial layer of the aortic intima (at protein level).
Database Links

HGNC: 13771

OMIM: 122860

KEGG: hsa:50964

STRING: 9606.ENSP00000301691

UniGene: Hs.349204

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*