Recombinant Human Sequestosome-1 (SQSTM1)

Code CSB-YP615696HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP615696HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP615696HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP615696HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
A170; DMRV; EBI 3 associated protein of 60 kDa; EBI 3 associated protein p60; EBI3 associated protein of 60 kDa; EBI3 associated protein p60; EBI3-associated protein of 60 kDa; EBIAP; FTDALS3; MGC127197; ORCA; OSF-6; Osi; OSIL; Oxidative stress induced like; p60; p62; p62B; Paget disease of bone 3; PDB 3; PDB3; Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa; Phosphotyrosine independent ligand for the Lck SH2 domain p62; Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa; PKC-zeta-interacting protein; Protein kinase C-zeta-interacting protein; Sequestosome 1; Sequestosome-1; SQSTM 1; SQSTM_HUMAN; Sqstm1; STAP; STONE14; Ubiquitin binding protein p62; Ubiquitin-binding protein p62; ZIP 3; ZIP; ZIP3
Species
Homo sapiens (Human)
Expression Region
1-356
Target Protein Sequence
MAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSV CPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPG NWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVEHGGK RSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEE QMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYP HLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Protein Length
Full Length of Isoform 2
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Autophagy receptor required for selective macroautophagy (aggrephagy). Functions as a bridge between polyubiquitinated cargo and autophagosomes. Interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family. Along with WDFY3, involved in the formation and autophagic degradation of cytoplasmic ubiquitin-containing inclusions (p62 bodies, ALIS/aggresome-like induced structures). Along with WDFY3, required to recruit ubiquitinated proteins to PML bodies in the nucleus. May regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1. May play a role in titin/TTN downstream signaling in muscle cells. May regulate signaling cascades through ubiquitination. Adapter that mediates the interaction between TRAF6 and CYLD. May be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels. Involved in endosome organization by retaining vesicles in the perinuclear cloud: following ubiquitination by RNF26, attracts specific vesicle-associated adapters, forming a molecular bridge that restrains cognate vesicles in the perinuclear region and organizes the endosomal pathway for efficient cargo transport. Promotes relocalization of 'Lys-63'-linked ubiquitinated STING1 to autophagosomes. Acts as an activator of the NFE2L2/NRF2 pathway via interaction with KEAP1: interaction inactivates the BCR(KEAP1) complex, promoting nuclear accumulation of NFE2L2/NRF2 and subsequent expression of cytoprotective genes.
Gene References into Functions
  1. Study shows that p62 hijacked NOXA for its degradation during autophagy. PMID: 29758299
  2. A complex of C9ORF72 and p62 uses arginine methylation to eliminate stress granules by autophagy. PMID: 30022074
  3. Study demonstrated that the expression of p62 was upregulated in 4nitroquinoline1oxideinduced oral carcinogenesis, accompanied with myeloidderived suppressor cells and regulatory T cells accumulation. PMID: 30272335
  4. High p62 cytoplasmic expression on its own (p PMID: 29897944
  5. the complex structures between the ZZ-domain of p62 and various type-1 and type-2 N-degrons, are reported. PMID: 30120248
  6. the role of p62 in energy metabolism was studied in fibroblasts. PMID: 28490746
  7. p62 and ubiquitinated proteins spontaneously coalesce into larger clusters. Efficient cluster formation requires substrates modified with at least two ubiquitin chains longer than three moieties and is based on p62 filaments cross-linked by the substrates. PMID: 29343546
  8. 27-OH induced autophagy is dependent on the relation between nuclear factor erythroid 2 p45-related factor 2 (Nrf2)-dependent antioxidant response and p62. PMID: 29879549
  9. our results showed that high CD44 led to p62-associated NRF2 activation in CD44(high) breast CSC-like cells. NRF2 activation contributed to the aggressive phenotype, tumor growth, and anticancer drug resistance of CD44(high) CSCs PMID: 29729523
  10. results suggested that p62 plays a protective role in adipogenesis of human adipose-derived stromal cells through regulating mitophagy. PMID: 29866118
  11. The results of the present study demonstrated that p62 may aggravate LPSinduced acute kidney injury in mice by promoting apoptosis in renal tubular epithelial cells. PMID: 29620262
  12. Study supports HuR's role as an upstream regulator of p62 expression in ARPE-19 cells, helps to understand better the early events in response to a proautophagy stimulus. PMID: 29576851
  13. Therefore in this review we discuss the role of p62 in autophagy, apoptosis and cancer through its different domains and outline the importance of modulating cellular levels of p62 in cancer therapeutics. PMID: 29738493
  14. Both the metastatic and recurrent tumor tissues expressed less p62 than the patient-matched primary tumor. A significant inverse correlation has been found between p62 expression and both the disease-free survival and overall survival. PMID: 29699801
  15. p62 deficiency in stromal fibroblasts promotes resistance to glutamine deprivation by the direct control of ATF4 stability through its p62-mediated polyubiquitination. PMID: 28988820
  16. AGG is also found to trigger ubiquitination of PUMA which in turn interacted with p62 for prompting mitophagy suggesting that AGG turns on PUMA-mediated mitophagy in U87MG cells in both p62-dependent as well as in p62-independent manner PMID: 29229477
  17. The results suggest that p62 may be an effective predictor of prognosis and a potential target for therapy in osteosarcoma. PMID: 29617702
  18. The model reveals a compensatory autophagic pathway, mediated by a SQSTM1/p62-dependent clearance of accumulated polyubiquitinated proteins. In addition to mediating the sequestration of ubiquitinated cargos into phagophores, the precursors to autophagosomes, SQSTM1 is also important for polyubiquitinated aggregate formation upon proteasomal inhibition. PMID: 28792301
  19. ESI induces protective autophagy of lung cancer cells through Nrf2-p62-keap1 feedback loop PMID: 28617433
  20. IFN-gamma induces activated but insufficient autophagy and thus contributes to a degree to p62-dependent apoptosis of nasal epithelial cells in chronic rhinosinusitis with nasal polyps. PMID: 28258963
  21. The underling mechanism of autophagy/p62/Nrf2 pathway discovered may provide a new direction for drug development. PMID: 28737825
  22. Study show the proteasome autophagy mechanism is mediated by the p62/SQSTM1 adapter and requires its ubiquitin-associated domain. Independently, p62 serves also as a shuttling protein for ubiquitinated substrates, using its PB1 domain. This places p62 in a pivotal position where under certain conditions it binds to the proteasome as a protease, whereas in other conditions it recognizes the proteasome as a prey. PMID: 27791183
  23. The study describes a previously uncharacterized cellular response induced by heme: the formation of p62/SQSTM1 aggregates containing ubiquitinated proteins in structures known as aggresome-like induced structures (ALIS). This action is part of a response driven by the transcription factor NRF2 to the excessive generation of reactive oxygen species induced by heme. PMID: 27821769
  24. The data identify an intricate mechanism of hepatitis C virus-dependent inhibition of Nrf2/ antioxidant response elements-mediated gene expression which counteracts serine 349-phosphorylated p62-induced activation of Nrf2. PMID: 28673615
  25. Results identified SQSTM1, a regulator of apoptosis and autophagy, to be hyper-phosphorylated and associated with development of cisplatin resistance in high-grade serous ovarian cancer. PMID: 28455291
  26. p62 immunoreactivity was detected in 11% of colorectal adenoma and 31% of the adenocarcinoma cases, and almost negligible in the normal epithelium. p62 promotes cell proliferation in colorectal carcinoma cells, was significantly associated with synchronous liver metastasis in the colorectal carcinoma cases, and was an independent adverse prognostic factor for overall survival in the colorectal cancer patients. PMID: 28544335
  27. NEDD4 is an autophagic E3 ubiquitin ligase that ubiquitylates SQSTM1, facilitating SQSTM1-mediated inclusion body autophagy. PMID: 29021346
  28. SQSTM1/p62 senses the saturation of reactive oxygen species (ROS)-buffering systems, and that this redox-sensitivity is important to increase autophagy, and thus ensure the survival of cells under oxidative stress conditions. PMID: 29343728
  29. This study is the first to show a cytoplasmic function of claudin 1 as an autophagy regulator and provides the evidence that claudin 1-mediated autophagy regulation is an integral part of the mechanism by which claudin 1 regulates cancer progression. PMID: 29307823
  30. The autophagy induced by 2-PCPA requires LC3-II processing machinery..2-PCPA treatment induces the change of global gene expression program, including a series of autophagy-related genes, such as SQSTM1/p62. Taken together, our data indicate that KDM1A/LSD1 inhibitors induce autophagy through affecting the expression of autophagy-related genes and in a BECN1-independent manner PMID: 28800922
  31. The results of this study reflect that Frontotemporal Dementia /SQSTM1 carriers show a right atrophy pattern in prefrontal-orbital-insular regions with relative preservation of the temporal lobes different from that observed in Sporadic Frontotemporal Dementia. PMID: 27163810
  32. the L341V mutation limits the critical step of SQSTM1 recruitment to the phagophore PMID: 27158844
  33. Endogenous p62 undergoes E2-dependent ubiquitylation during upregulation of Ubiquitin (Ub) homeostasis, a condition termed as Ub(+) stress, that is intrinsic to Ub overexpression, heat shock or prolonged proteasomal inhibition by bortezomib, a chemotherapeutic drug. PMID: 28322253
  34. LC3 and p62/SQSTM1 have roles in early-stage non-small cell lung cancer PMID: 27250032
  35. LC3B and p62 have roles in autophagy in esophageal adenocarcinoma PMID: 27250034
  36. ALS-FTLD associated mutations of SQSTM1 disrupt Keap1 binding and disable Nrf2 signaling. PMID: 27554286
  37. analysis of soluble SQSTM1 complexes and soluble complexes formed between SQSTM1 oligomers and LC3 using a combination of fluorescence microscopy-based biophysical approaches in living cells PMID: 27442348
  38. CAL suppresses the expression of pro-inflammatory cytokines via p62/Nrf2-linked HO-1 induction in RASFs. PMID: 27678042
  39. Vps34 stimulates tumor development mainly through PKC-delta- activation of p62. PMID: 28846113
  40. casein kinase 1 phosphorylates the SQSTM1 S349 residue when harmful proteins accumulate under HSF1 stress PMID: 27846364
  41. SQSTM1 binds and inhibits E3 ligase RNF168s activity, which is essential for H2A ubiquitination PMID: 27791533
  42. this study proved that SYVN1 enhances SERPINA1(E342K)/ATZ degradation through SQSTM1-dependent autophagy and attenuates SERPINA1(E342K)/ATZ cytotoxicity. PMID: 28121484
  43. The authors show that ufmylation regulates SQSTM1 by eliciting a cell type-specific endoplasmic reticulum stress response which induces SQSTM1 expression and results in its accumulation in the cytosol. PMID: 27351204
  44. TRIM11 suppresses AIM2 inflammasome by degrading AIM2 via p62-dependent selective autophagy. PMID: 27498865
  45. These data define that YOD1 antagonizes TRAF6/p62-dependent IL-1 signaling to NF-kappaB. PMID: 28244869
  46. Data show that p62 interaction with LC3, leading to the delivery of p62 and its cargoes to the autophagosome. PMID: 28740232
  47. These results demonstrate a novel SQSTM1 regulatory network that promotes a nickel-induced tumorigenic effect in human bronchial epithelial cells. PMID: 27467530
  48. Thyroid hormone promotes selective autophagy via induction of DAPK2-SQSTM1 cascade, which in turn protects hepatocytes from diethylnitrosamine-induced hepatotoxicity or carcinogenesis. PMID: 27653365
  49. P62 functions as a tumour metastasis promoter. PMID: 28968743
  50. Silence of p62 promotes apoptosis induced by mitochondrial depolarization. PMID: 28433685

Show More

Hide All

Involvement in disease
Paget disease of bone 3 (PDB3); Frontotemporal dementia and/or amyotrophic lateral sclerosis 3 (FTDALS3); Neurodegeneration with ataxia, dystonia, and gaze palsy, childhood-onset (NADGP); Myopathy, distal, with rimmed vacuoles (DMRV)
Subcellular Location
Cytoplasm, cytosol. Late endosome. Lysosome. Cytoplasmic vesicle, autophagosome. Nucleus. Endoplasmic reticulum. Nucleus, PML body. Cytoplasm, myofibril, sarcomere.
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 11280

OMIM: 167250

KEGG: hsa:8878

STRING: 9606.ENSP00000374455

UniGene: Hs.587290

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1