Recombinant Human Serine racemase (SRR)

In Stock
Code CSB-EP022691HUc0
Abbreviation Recombinant Human SRR protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SRR
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-340aa
Target Protein Sequence
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.
Gene References into Functions
  1. SRR was identified as a type 2 diabetes susceptibility gene. SRR plays a role in insulin secretion in vitro. PMID: 28580277
  2. rs391300 SNP, located on the serine racemase (SRR) gene and linked to increased susceptibility to type 2 diabetes, was associated with progression from mild cognitive impairment to probable Alzheimer's disease. PMID: 29338921
  3. Study found an inverse association between the genetic risk off schizophrenia based on 108 genome-wide significantly associated SNPs and the prevalence for treated migraine in a general population sample. This association was primary linked to SNPs associated with genes encoding proteins involved in glutamatergic neurotransmission and could be attributed to the single intronic variant rs4523957 in SRR. PMID: 27394076
  4. Data suggest that Ser-84 and Arg-135 are important in catalysis and substrate specificity of SRR. PMID: 28696262
  5. Magnesium and calcium ions differentially affect human serine racemase activity and modulate its quaternary equilibrium toward a tetrameric form PMID: 28089597
  6. MiR-193a-3p and miR-193a-5p play important roles in osteosarcoma metastasis through down-regulation of the Rab27B and SRR genes and therefore may serve as useful biomarkers for the diagnosis of osteosarcoma PMID: 26913720
  7. Loss-of-function mutation of the gene encoding serine racemase significantly attenuates excitotoxicity in retina. PMID: 26485193
  8. Serine racemase activity and dynamics are regulated by halides, ATP and malonate. PMID: 25331425
  9. In serine racemase, similarly to the related enzyme alanine racemase, the unprotonated pyridoxal-5'-phosphate -substrate intermediate is stabilized mostly due to solvation effects contributed by water molecules and active-site residues. PMID: 25493718
  10. FBXO22 protein is required for optimal synthesis of NMDA receptor coagonist D-serine by interacting with serine racemase, activating it, and preventing its targeting to membranes. PMID: 25336657
  11. cross-talk between allosteric and active sites, leading to the stabilization of two alternative protein conformations with ATP affinities of ~ 10 muM and 1.8 mm PMID: 23992455
  12. S84A serine racemase mutant behaved like serine dehydratase, whereas A65S serine dehydratase mutant acquired an additional function of using D-serine as a substrate. PMID: 23112234
  13. The structural characteristics of SR obtained from live cells suggest that SR is sensitive to oxidation in vivo, perhaps consistent with a scenario in which such modification plays a role in feedback or other forms of regulation. PMID: 22151352
  14. Serine racemase and D-serine are involved in both pre-symptomatic and progressive phases of amyotrophic lateral sclerosis, demonstrating a link between mutant superoxide dismutase (SOD)1 and a glial-derived toxic mediator in transgenic mice. PMID: 22117694
  15. The SRR mRNA is elevated in people death with suicide. PMID: 20385472
  16. The structure of mammalian serine racemase: evidence for conformational changes upon inhibitor binding PMID: 20106978
  17. Data report on the isolation of a cDNA encoding a human serine racemase (SRR) from a human neuronal like cell line. PMID: 15193426
  18. D-serine is synthesized in human placenta by the racemization of L-serine by serine racemase. PMID: 15219883
  19. serine racemase catalyzes the degradation of cellular D-serine itself, through the alpha,beta-elimination of water PMID: 15536068
  20. The frequency of the genotypes showed that 5'-G/C serine racemase is not a major risk factor for schizophrenia. PMID: 16446740
  21. Expression of serine racemaseusing Western blot analysis in postmortem hippocampus and cortex in schizophrenia and a comparison group. PMID: 16837850
  22. Not associated with schizophrenia in a Gefman case-control study. PMID: 17413455
  23. Not associated with bipolar disorder in a German case-control study. PMID: 17413456
  24. observed activation of serine racemase by divalent cations has been assumed to be a side-effect associated with ATP binding, which is known to form a complex with Mg(2+) ions PMID: 17697119
  25. serine racemase and D-amino acid oxidase are expressed in human brain and demonstrate aberrant D-serine metabolism in schizophrenia PMID: 17880399
  26. Analysis of SRR genetic variants in humans identified a robust association with schizophrenia. PMID: 19483194

Show More

Hide All

Protein Families
Serine/threonine dehydratase family
Tissue Specificity
Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver.
Database Links

HGNC: 14398

OMIM: 606477

KEGG: hsa:63826

STRING: 9606.ENSP00000339435

UniGene: Hs.461954

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*