Recombinant Human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PPP2R2A)

In Stock
Code CSB-EP018564HU
Abbreviation Recombinant Human PPP2R2A protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
PP2A subunit B isoform B55-alpha;PP2A subunit B isoform PR55-alpha;PP2A subunit B isoform R2-alpha;PP2A subunit B isoform alpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-447aa
Target Protein Sequence
AGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Essential for serine/threonine-protein phosphatase 2A-mediated dephosphorylation of WEE1, preventing its ubiquitin-mediated proteolysis, increasing WEE1 protein levels, and promoting the G2/M checkpoint.
Gene References into Functions
  1. Data show that SAM Domain and HD Domain-Containing Protein 1 (SAMHD1) is specifically targeted by protein phosphatase 2 regulatory subunit Balpha protein (PP2A-B55alpha) holoenzymes during mitotic exit. PMID: 29884836
  2. the data suggested that miR614 promoted cell proliferation and inhibited cell apoptosis of ovarian cancer (OC) cells by targeting PPP2R2A, and may therefore act as a potential target for OC therapy in the future. PMID: 29532877
  3. these results provide a novel insight into the role of PP2A-B55alpha as a novel meiotic and embryonic competence factor at the onset of life. PMID: 28439046
  4. we propose that the Smad4-Pitx2-PPP2R2A axis, a new signaling pathway, suppresses the pancreatic carcinogenesis PMID: 26848620
  5. These data unravel B55alpha as a PHD2 substrate and highlight a role for PHD2-B55alpha in the response to nutrient deprivation. PMID: 28329677
  6. results suggest that PR55alpha promotes pancreatic cancer development by sustaining hyperactivity of multiple oncogenic signaling pathways, including AKT, ERK, and Wnt PMID: 26893480
  7. miR-222 targets protein phosphatase 2A subunit B in bladder cancer cells. PMID: 26800397
  8. miR-556-5p functions as an onco-miRNA and participates in prostate cancer carcinogenesis by suppressing PPP2R2A expression. PMID: 26297546
  9. Data show that breast cancer (BC) with PPP2R2A deletions are associated with worse overall survival, and the combination of altered PPP2R2A and high CCND1 expression define a subgroup of luminal-like BC patients with a high risk of relapse and death. PMID: 25879784
  10. overexpression of miR-892a may provide a selective growth promotion for colorectal cancer cells by direct suppression of PPP2R2A expression. PMID: 26054685
  11. miR-136 may play an important role during TGF-beta1-induced proliferation arrest by targeting PPP2R2A in keratinocytes. PMID: 25654102
  12. Data suggest livers of biliary atresia subjects exhibit overexpression of MIR222 (microRNA 222); this appears to contribute to liver fibrosis (and in vitro cell proliferation) by targeting PPP2R2A (protein phosphatase 2A subunit B) and Akt signaling. PMID: 25238119
  13. The suppression of B55alpha activates signaling pathways that could support leukemia cell survival. PMID: 24858343
  14. Identification of the adenovirus E4orf4 protein binding site on the B55alpha and Cdc55 regulatory subunits of PP2A: Implications for PP2A PMID: 24244166
  15. miR-136 promotes Erk1/2 phosphorylation through targeting PPP2R2A in NSCLC cells and suggest that it may serve as a therapeutic target in NSCLC therapy. PMID: 23959478
  16. PPP2R2A status may serve as a marker to predict therapeutic efficacy to PARP inhibition. PMID: 23087057
  17. Both B55alpha and nuclear forkhead box O1 protein (FOXO1) levels are increased under hyperglycemic conditions in transgenic db/db mouse islets, an animal model of type 2 diabetes. PMID: 22417654
  18. These data demonstrate that B55alpha acts to antagonize Cyclin A/Cdk-dependent activation of FoxM1, to ensure that FoxM1 activity is restricted to the G(2) phase of the cell cycle. PMID: 21813648
  19. Somatic deletion rather than germline sequence variants of PPP2R2A may play a more important role in prostate cancer susceptibility. PMID: 21872824
  20. The interaction of human adenovirus E4orf4 with both Cdc55 and B55 involves residues within blades 1 and 2, a finding that is consistent with the idea that E4orf4 binding may block the dephosphorylation of at least some PP2A substrates. PMID: 21047956
  21. cyclin G2 also associates with various PP2A B' regulatory subunits, as previously shown for cyclin G1 PMID: 11956189
  22. CFTR is regulated by a direct interaction with the protein phosphatase 2A PMID: 16239222
  23. PP2A ABalphaC and ABdeltaC holoenzymes function as positive regulators of Raf1-MEK1/2-ERK1/2 signaling by targeting Raf1 PMID: 16239230
  24. hAR is a direct target of LEF-1/TCF transcriptional regulation in PCa cells; expression of the hAR protein is suppressed by a degradation pathway regulated by cross-talk of Wnt, Akt, and PP2A PMID: 16474850
  25. Bub1 targets PP2A to centromeres, which in turn maintains Sgo1 at centromeres by counteracting Plk1-mediated chromosome removal of Sgo1. PMID: 16580887
  26. deregulation of CHEK2 and/or PPP2R2A is of pathogenetic importance in at least a subset of germ cell tumors PMID: 16790090
  27. The scaffolding subunit exhibits considerable conformational flexibility, which is proposed to play an essential role in PP2A function. PMID: 17055435
  28. PP2A binding to Sprouty2 and phosphorylation changes are a prerequisite for ERK inhibition downstream of FGFR stimulation PMID: 17255109
  29. Protein phosphatase 2A and separase form a complex regulated by separase autocleavage PMID: 17604273
  30. the protein phosphatase 2A regulatory subunit alpha4 has a novel role in the regulation of cell spreading and migration PMID: 17693407
  31. PP2A constitutively dephosphorylates the class IIa member HDAC7 to control its biological functions as a regulator of T cell apoptosis and endothelial cell functions. PMID: 18339811
  32. Homozygous deletions in a number of biologically important genes were found in prostate cancer cell lines, including PPP2R2A and BNIP3L identified in this study. PMID: 18670647
  33. These highly related members of the same subfamily of PP2A regulatory subunits differentially regulate TGF-beta/Activin/Nodal signalling to elicit opposing biological outcomes. PMID: 18697906
  34. The authors show that E4orf4 protein interacts uniquely with B55 family subunits and that cell killing increases with the level of E4orf4 expression. PMID: 19535438
  35. The results suggest that PR55 alpha specifically regulates PP2A-mediated beta-catenin dephosphorylation and plays an essential role in Wnt signaling. PMID: 19556239

Show More

Hide All

Protein Families
Phosphatase 2A regulatory subunit B family
Tissue Specificity
Expressed in all tissues examined.
Database Links

HGNC: 9304

OMIM: 604941

KEGG: hsa:5520

STRING: 9606.ENSP00000325074

UniGene: Hs.146339

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*