Home
Protein
Recombinant Proteins
Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial

Code	CSB-EP761623HU
Abbreviation	Recombinant Human SIGLEC15 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SIGLEC15

Uniprot No.

Q6ZMC9

Research Area

Others

Alternative Names

CD33 antigen-like 3; CD33 molecule-like 3; CD33L3; HsT1361; Sialic acid-binding Ig-like lectin 15; SIG15_HUMAN; Siglec-15; SIGLEC15

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

20-263aa

Target Protein Sequence

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

42.6kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human SIGLEC15 protein is a powerful resource for researchers investigating sialic acid-binding Ig-like lectin 15 (Siglec-15). Known for its roles in various biological processes, including immune regulation and cell adhesion, SIGLEC15 is a valuable target for scientific exploration in both health and disease.

Our Recombinant Human SIGLEC15 protein is expressed in E.coli, resulting in the production of the extracellular domain (20-263aa). This protein features an N-terminal 6xHis-SUMO tag, allowing for efficient purification and detection while maintaining native structure and function. With a purity greater than 90% as determined by SDS-PAGE, this Recombinant Human SIGLEC15 protein delivers the reliability and consistency essential for your research efforts. Choose between liquid and lyophilized powder formats to best accommodate your experimental requirements.