Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R)

Code CSB-EP008789HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. A6ND01
Relevance Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008789HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IZUMO1R.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008789HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IZUMO1R.
Storage Buffer Tris-based buffer,50% glycerol
Alias Folate receptor 4 Folate receptor delta Short name: FR-delta IZUMO1 receptor protein JUNO
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
Research Area Developmental Biology
Source E.coli
Gene Names IZUMO1R
Protein Names Recommended name: Probable folate receptor delta Short name= FR-delta Alternative name(s): Folate receptor 4
Expression Region 20-250aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 30.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for species-specific gamete recognition and fertilization. The IZUMO1
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Folate receptor family
Database Links

HGNC: 32565

OMIM: 615737

KEGG: hsa:390243

STRING: 9606.ENSP00000416935

UniGene: Hs.553758

Pathway Endocytosis

Related Products

IZUMO1R Antibodies

IZUMO1R Antibodies for Homo sapiens (Human)

IZUMO1R Proteins

IZUMO1R Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.