Code | CSB-EP022817HU |
Size | US$1726 |
Image |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | STATH |
Uniprot No. | P02808 |
Research Area | others |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 20-62aa |
Target Protein Sequence | DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 23.7 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info | N-terminal 10xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Regarding your protein CSB-EP022817HU, could you please provide information for all available sizes?
Also, have you removed the tags from this protein before?
DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
Function | Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface. |
Subcellular Location | Secreted |
Protein Families | Histatin/statherin family |
Tissue Specificity | Secreted by parotid and submandibular glands. |
Database Links |
HGNC: 11369 OMIM: 184470 KEGG: hsa:6779 STRING: 9606.ENSP00000246895 UniGene: Hs.654495 |
Recombinant Human Replication factor C subunit 1(RFC1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Eukaryotic translation initiation factor 3 subunit E(EIF3E)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 1(KRT1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase(GAPDH)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Bcl-2-like protein 11(BCL2L11)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Tumor necrosis factor ligand superfamily member 12(TNFSF12),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Aflatoxin B1 aldehyde reductase member 3(AKR7A3)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide