Recombinant Human Statherin(STATH)

Code	CSB-EP022817HU
Size	US$1726
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Q&A and Customer Reviews
Target Data

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	STATH
Uniprot No.	P02808
Research Area	others
Alternative Names	STAT_HUMAN; STATH; Statherin; Statherin precursor ; STR
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	20-62aa
Target Protein Sequence	DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	23.7 kDa
Protein Length	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Q&A and Customer Reviews

■ Q&A

Regarding your protein CSB-EP022817HU, could you please provide information for all available sizes?
Also, have you removed the tags from this protein before?

Thanks for your inquiry.
Recombinant Human Statherin(STATH)
CSB-EP022817HU >> E.coli
Expression Region: 20-62aa; Mature full length protein.
Tag information:N-terminal 10xHis-SUMO-tagged
Sequence:

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

We haven't tried to remove the tags of any of these proteins before, we can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%, but we should explaing to you in advance:
Not all protein tags can be removed as some proteins will be very unstable after tag removal.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days. Please remark your requirements when placing the order.

Target Data

Function	Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
Gene References into Functions	The total protein and statherin in the in-vivo AEP were different between eroded and non-eroded tooth surfaces of the same patient PMID: 28837608 effects of statherin on intracellular calcium level and its subsequent related molecular alterations would give us new pathogenic aspect in oral carcinogenesis PMID: 25128293 phenylalanine orientations in statherin bound to hydroxyapatite surfaces PMID: 22563672 Data show that the full characterization of the statherin peptides generated facilitates the elucidation of their novel functional roles in the oral and gastro-intestinal environment. PMID: 20731414 insight into the molecular interactions of statherin with hydroxyapatite surfaces PMID: 19678690 inhibits calcium phosphate precipitation PMID: 12060866 results suggest that a layer rich in statherin forms at the interface of saliva and air, and that the surface rheology developed is dependent upon protein interactions mediated by calcium PMID: 15769251 In conclusion, statherin induces transition to yeast of Candida albicans hyphae and may thus contribute to the oral defense against candidiasis. PMID: 19799638 Show More Hide All
Subcellular Location	Secreted
Protein Families	Histatin/statherin family
Tissue Specificity	Secreted by parotid and submandibular glands.
Database Links	HGNC: 11369 OMIM: 184470 KEGG: hsa:6779 STRING: 9606.ENSP00000246895 UniGene: Hs.654495