Recombinant Human Statherin(STATH)

Code CSB-EP022817HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P02808
Relevance Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
Research Area others
Source E.coli
Gene Names STATH
Protein Names Recommended name: Statherin
Expression Region 20-62aa
Tag Info N-terminal 10xHis-SUMO-tagged
Mol. Weight 23.7 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
Subcellular Location Secreted
Protein Families Histatin/statherin family
Tissue Specificity Secreted by parotid and submandibular glands.
Database Links

HGNC: 11369

OMIM: 184470

KEGG: hsa:6779

STRING: 9606.ENSP00000246895

UniGene: Hs.654495

Q&A and Customer Reviews

Q&A
Q:

Regarding your protein CSB-EP022817HU, could you please provide information for all available sizes?
Also, have you removed the tags from this protein before?

A:
Thanks for your inquiry.
Recombinant Human Statherin(STATH)
CSB-EP022817HU >> E.coli
Expression Region: 20-62aa; Mature full length protein.
Tag information:N-terminal 10xHis-SUMO-tagged
Sequence:

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF


We haven't tried to remove the tags of any of these proteins before, we can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%, but we should explaing to you in advance:
Not all protein tags can be removed as some proteins will be very unstable after tag removal.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days. Please remark your requirements when placing the order.
Customer Reviews

Related Products

STATH Antibodies

STATH Antibodies for Homo sapiens (Human)

STATH Proteins

STATH Proteins for Homo sapiens (Human)

STATH ELISA Kit

STATH ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.