Name: Recombinant Human Statherin (STATH)
Brand: CUSABIO
SKU: CSB-EP022817HU

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

STATH

Uniprot No.

P02808

Research Area

others

Alternative Names

STAT_HUMAN; STATH; Statherin; Statherin precursor ; STR

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

20-62aa

Target Protein Sequence

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

23.7 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Regarding your protein CSB-EP022817HU, could you please provide information for all available sizes?
Also, have you removed the tags from this protein before?

Thanks for your inquiry.
Recombinant Human Statherin(STATH)
CSB-EP022817HU >> E.coli
Expression Region: 20-62aa; Mature full length protein.
Tag information:N-terminal 10xHis-SUMO-tagged
Sequence:

DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF

We haven't tried to remove the tags of any of these proteins before, we can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%, but we should explaing to you in advance:
Not all protein tags can be removed as some proteins will be very unstable after tag removal.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days. Please remark your requirements when placing the order.

Target Background

Function

Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.

Gene References into Functions

The total protein and statherin in the in-vivo AEP were different between eroded and non-eroded tooth surfaces of the same patient PMID: 28837608
effects of statherin on intracellular calcium level and its subsequent related molecular alterations would give us new pathogenic aspect in oral carcinogenesis PMID: 25128293
phenylalanine orientations in statherin bound to hydroxyapatite surfaces PMID: 22563672
Data show that the full characterization of the statherin peptides generated facilitates the elucidation of their novel functional roles in the oral and gastro-intestinal environment. PMID: 20731414
insight into the molecular interactions of statherin with hydroxyapatite surfaces PMID: 19678690
inhibits calcium phosphate precipitation PMID: 12060866
results suggest that a layer rich in statherin forms at the interface of saliva and air, and that the surface rheology developed is dependent upon protein interactions mediated by calcium PMID: 15769251
In conclusion, statherin induces transition to yeast of Candida albicans hyphae and may thus contribute to the oral defense against candidiasis. PMID: 19799638

Hide All

Subcellular Location

Secreted.

Protein Families

Histatin/statherin family

Tissue Specificity

Secreted by parotid and submandibular glands.

Database Links

HGNC: 11369

OMIM: 184470

KEGG: hsa:6779

STRING: 9606.ENSP00000246895

UniGene: Hs.654495

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address