Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP022817HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P02808 |
| Relevance | Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF |
| Research Area | others |
| Source | E.coli |
| Gene Names | STATH |
| Protein Names | Recommended name: Statherin |
| Expression Region | 20-62aa |
| Tag Info | N-terminal 10xHis-SUMO-tagged |
| Mol. Weight | 23.7 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface. |
| Subcellular Location | Secreted |
| Protein Families | Histatin/statherin family |
| Tissue Specificity | Secreted by parotid and submandibular glands. |
| Database Links |
HGNC: 11369 OMIM: 184470 KEGG: hsa:6779 STRING: 9606.ENSP00000246895 UniGene: Hs.654495 |
Regarding your protein CSB-EP022817HU, could you please provide information for all available sizes?
Also, have you removed the tags from this protein before?
DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
STATH Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA022817GA01HU | STATH Antibody | Human | ELISA,WB |
| CSB-PA022817ZA01HU | STATH Antibody | Homo sapiens | ELISA, WB (ensure identification of antigen) |
STATH Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP022817HU CSB-BP022817HU CSB-MP022817HU |
Recombinant Human Statherin(STATH) | Yeast Baculovirus Mammalian cell |
STATH ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL022817HU | Human Statherin(STATH) ELISA kit | serum, plasma, tissue homogenates, saliva | 19.5 ng/mL |
Recombinant Horse Serum amyloid A protein(SAA1)
Express system: E.coli
Species: Equus caballus (Horse)
Recombinant Human F-actin-capping protein subunit beta(CAPZB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human CCAAT/enhancer-binding protein gamma(CEBPG)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Oxytocin-neurophysin 1(OXT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Glutathione S-transferase A2(GSTA2)
Express system: E.coli
Species: Homo sapiens (Human)
