Recombinant Human Sterol regulatory element-binding protein 1 (SREBF1), partial, Biotinylated

Code CSB-EP022657HU1-B
Abbreviation Recombinant Human SREBF1 protein, partial, Biotinylated
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Class D basic helix-loop-helix protein 1;Sterol regulatory element-binding transcription factor 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-487aa
Target Protein Sequence
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
98.0 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.111.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis and lipid homeostasis.; Key transcription factor that regulates expression of genes involved in cholesterol biosynthesis and lipid homeostasis. Binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Has dual sequence specificity binding to both an E-box motif (5'-ATCACGTGA-3') and to SRE-1 (5'-ATCACCCCAC-3'). Regulates the promoters of genes involved in cholesterol biosynthesis and the LDL receptor (LDLR) pathway of sterol regulation.; Isoform expressed only in select tissues, which has higher transcriptional activity compared to SREBP-1C. Able to stimulate both lipogenic and cholesterogenic gene expression. Has a role in the nutritional regulation of fatty acids and triglycerides in lipogenic organs such as the liver. Required for innate immune response in macrophages by regulating lipid metabolism.; Predominant isoform expressed in most tissues, which has weaker transcriptional activity compared to isoform SREBP-1A. Primarily controls expression of lipogenic gene. Strongly activates global lipid synthesis in rapidly growing cells.; The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.; The absence of Golgi proteolytic processing requirement makes this isoform constitutively active in transactivation of lipogenic gene promoters.
Gene References into Functions
  1. results reveal that nBP1a/PKM2 interaction activates lipid metabolism genes in cancer cells and that Thr-59 phosphorylation of SREBP-1a plays an important role in cancer cell proliferation. PMID: 29514980
  2. GTEE also downregulated the expression of AR and prostate-specific antigen (PSA) in both androgen-responsive and castration-resistant PCa cells. By blocking the SREBP-1/AR axis, GTEE suppressed cell growth and progressive behaviors, as well as activating the caspase-dependent apoptotic pathway in PCa cells PMID: 30301150
  3. SREBP1 trans-activates CYP24A1 expression through SREBP binding elements present in the promoter. PMID: 29653103
  4. Berberine (BBR), an effective suppressor of SREBP1 and lipogenesis regulated through reactive oxygen species (ROS)/AMPK pathway, selectively inhibited the growth of G-R nonsmall cell lung cancer cells and rheumatoid arthritis patiens but not that of normal cells PMID: 28665143
  5. These findings suggest that SREBP-1c serves as a molecular bridge between lipid metabolism and cell cycle control inclear cell renal cell carcinoma tumorigenesis. PMID: 29138263
  6. findings showed that PTEN inhibits HBV replication as well as HBV HCV co-replication. SREBP-1 is involved in HBV HCV replication inhibition by PTEN PMID: 29803738
  7. FTO increased the lipid accumulation in hepatocytes by increasing nuclear translocation of SREBP1c and SREBP1c maturation, thus improving the transcriptional activity of lipid droplet-associated protein CIDEC. PMID: 29486327
  8. common SNPs (rs62064119, rs2297508, rs11868035 and rs13306741) in the SREBP-1c gene were selected and genotyped in 593 Han patients with NAFLD and 593 healthy controls. No significant differences in genotype and allele frequencies of these four SNPs were found between cases and controls, suggesting that the SNPs are not associated with risk of NAFLD in the Chinese Han population. PMID: 27572914
  9. Data suggests that expression of CYP4F2 is down-regulated in liver of mice with non-alcoholic fatty liver disease after high-fat/Western diet and in human hepatocyte cell line exposed to excess palmitic acid, oleic acid, or fructose. Two other genes are down-regulated, PPAR gamma and SREBP-1. (CYP4F2 = cytochrome P450 family 4 subfamily F member 2; PPAR = peroxisome proliferator-activated receptor ) PMID: 28628909
  10. LncARSR promotes hepatic lipogenesis via Akt/SREBP-1c pathway and contributes to the pathogenesis of nonalcoholic steatohepatitis. PMID: 29555473
  11. CpG sites located in SREBF2 gene showed differential methylation in association with lipid traits. The expression of SREBF1 gene was inversely associated with methylation of its corresponding CpGs. Genetic variants in SREBF1 were also associated with lipid profile. SREBF1 expression was directly associated with HDL cholesterol. PMID: 28173150
  12. Epidermal growth factor receptor (EGFR) signaling enhances miR-29 expression in glioblastoma cells via upregulation of Sterol regulatory element binding protein PMID: 27477273
  13. Our finding reveals a crucial roles for SREBP1 in lipid desaturation of ccRCC through regulation of NF-kappaB signaling, which provides not only new insights in regulatory mode of NF-kappaB signaling but also a novel target for potential metabolic therapies. PMID: 29183723
  14. Our results suggest that relatively common genetic variants in stearoyl CoA desaturase and SREBF1 attenuated the positive associations between intake of a traditional diet rich in n-3 polyunsaturated fatty acids and increases in fasting cholesterol and HbA1c levels, as well as the waist-to-hip ratio among Yup'ik participants. PMID: 27467133
  15. changes in distinct lipid ratios may converge on ARF1 to increase SBP-1/SREBP-1 activity. PMID: 27320911
  16. Variants in the TOM1L2/SREBF1 locus exert opposing effects of total-body lean mass (TB-LM) and total-body less head bone mineral density (TBLH-BMD) . PMID: 28743860
  17. Date indicate that sterol regulatory element-binding proteins Srebp1 and Srebp2 are essential for the metabolic reprogramming of NK cells and for the attainment of elevated glycolysis and oxidative phosphorylation. PMID: 28920951
  18. Study identified a novel human specific lncRNA, lncHR1, as a negative regulator of SREBP-1c expression. Overexpression of lncHR1 inhibited expression of SREBP-1c and fatty acid synthase (FAS) and then repressed oleic acid-induced hepatic cell triglyceride (TG) and lipid droplet (LD) accumulation. PMID: 28367099
  19. Glucose adsorption to chitosan membranes increases proliferation of human chondrocytes via mammalian target of rapamycin complex 1 and sterol regulatory element-binding protein-1 signaling. PMID: 28218386
  20. miR-185 negatively regulates the differentiation of 3T3-L1 cells by targeting SREBP-1 PMID: 28701079
  21. The authors further demonstrated that the upregulation of sterol regulatory element-binding protein (SREBP)-1c by activation of the Akt and p70S6K pathways is critical for high-glucose-treated Porphyromonas gingivalis-induced NLRP3 expression. PMID: 28083517
  22. Results show that PPARalpha is downregulated and SREBP-1c is upregulated in steatosis L-02 cells. These changes increase lipid synthesis and reduce lipid disposal, which ultimately lead to hepatic steatosis. PMID: 27270405
  23. SREBP-1 and SREBP-2 mRNA expression levels were measured in EAT from 49 patients with CAD (26 with diabetes) and 23 controls without CAD or diabetes.SREBP expression was associated as cardiovascular risk factor for the severity of CAD and the poor lipid control. PMID: 28367087
  24. The involvement of SREBP-1c in FASN promoter histone modification. PMID: 28027934
  25. the mitotic phosphorylation and stabilization of nuclear SREBP1 during cell division provides a link between lipid metabolism and cell proliferation. PMID: 27579997
  26. B7-H3 hijacks SREBP-1/FASN signaling mediating abnormal lipid metabolism in lung cancer PMID: 27939887
  27. The genetic polymorphisms of SREBF1 could play a role in the mechanism for interindividual variation of atypical antipsychotics-induced metabolic syndrome (MetS). SCAP polymorphisms with drug-induced MetS were negative in this study. PMID: 26982812
  28. NS5ATP6 regulates the intracellular triglyceride level via FGF21, and independently of SIRT1 and SREBP1. PMID: 27179781
  29. observations suggest that MALAT1 promotes hepatic steatosis and insulin resistance by increasing nuclear SREBP-1c protein stability. PMID: 26935028
  30. MiR-132 inhibited SIRT1 and SREBP-1c expression and downregulated their targeted genes, including HMGCR and FASN. PMID: 26898440
  31. Report demonstrated that overexpression of SULT2B1b-mediated angiogenic signaling was associated with tumor angiogenesis and poor clinical features of human gastric cancer. PMID: 26937945
  32. Data show that mutant p53 protein activates the sterol regulatory element-binding proteins SREBP-1 and SREBP-2-mediated signaling pathways in prostate cancer (PCa) cells. PMID: 26512780
  33. miR-33b is highly induced upon differentiation of human preadipocytes, along with SREBP-1 and miR-33b is an important regulator of adipogenesis PMID: 26830228
  34. Akt1 and Akt2 activated both SREBP-1 and SREBP-2, whereas Akt3 upregulated SREBP-1 to enhance hepatitis C virus translation. PMID: 26855332
  35. PRMT5-induced methylation prevented phosphorylation of SREBP1a on S430 by GSK3beta PMID: 26759235
  36. mTORC2 positively regulates mSREBP1 stability and lipogenesis. Findings reveal a novel biological function of mTORC2 in the regulation of lipogenesis PMID: 25893295
  37. mTORC1/SREBP pathway is a major mechanism through which common oncogenic signaling events induce de novo lipid synthesis to promote aberrant growth and proliferation of cancer cells PMID: 26028026
  38. hnRNP A1 is implicated in the free fatty acid-induced expression of SREBP-1a and of its target genes as well as in the lipid accumulation in hepatocytes. PMID: 26869449
  39. TG levels are regulated by HCBP6-sterol regulatory element binding protein 1c (SREBP1c)-mediated fatty acid synthase (FASN) expression. PMID: 25855506
  40. Aberrant activation of SREBP1c suppresses primary ciliogenesis by PLA2G3-mediated distortion of vesicular trafficking and suggest that PLA2G3 is a novel potential target to normalize ciliogenesis in SREBP1c-overexpressing cells, including cancer cells. PMID: 25904332
  41. PD-L1 induces epithelial-to-mesenchymal transition via activating SREBP-1c in renal cell carcinoma. PMID: 26141060
  42. performed a detailed promoter/enhancer analysis of ELOVL5 gene, and identified two new SREBP binding sites, one in the 10 kb upstream region and one in the exon 1 PMID: 26321664
  43. Data indicate that glucose-mediated glycosylation promotes SREBP cleavage-activating protein (SCAP) trafficking to the Golgi Leading to sterol regulatory element binding protein 1 (SREBP-1) activation. PMID: 26555173
  44. Single nucleotide polymorphism (rs2297508) of SREBF-1 may serve as a genetic predisposition factor for the development of endometrial cancer. PMID: 24614076
  45. Report PCR techniques for genotyping SREBF1 rs8066560 variant in Iranian children/adolescents with metabolic syndrome. PMID: 26771965
  46. Data show that the cleavage site of the lipid-signaling protein sterol regulatory element binding transcription factor 1 (SREBP-1) intermediate bears rigid alpha-helical topology. PMID: 26392539
  47. We concluded that 54(G/C) polymorphism of SREBF-1 gene is associated with polycystic ovary syndrome (PCOS) and suggest that SREBF-1 gene may play a role in genetic predisposition to PCOS. PMID: 25801724
  48. The results from this study demonstrate that metformin ameliorates PA-induced insulin resistance through the activation of AMPK and the suppression of SREBP-1c in skeletal muscle cells. PMID: 25891779
  49. Associations between triglyceride levels and SREBF1 and ABCG1 were also found in adipose tissue of the Multiple Tissue Human Expression Resource cohort PMID: 25583993
  50. gene expression analysis revealed that SREBP defines a gene signature that is associated with poor survival in glioblastoma PMID: 25619842

Show More

Hide All

Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.; [Isoform SREBP-1aDelta]: Nucleus.; [Isoform SREBP-1cDelta]: Nucleus.
Protein Families
SREBP family
Tissue Specificity
Expressed in a wide variety of tissues, most abundant in liver and adrenal gland. In fetal tissues lung and liver shows highest expression.; [Isoform SREBP-1A]: Predominates in hepatoma cell lines. Also expressed in kidney, brain, white fat, and muscle.;
Database Links

HGNC: 11289

OMIM: 184756

KEGG: hsa:6720

STRING: 9606.ENSP00000348069

UniGene: Hs.592123

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*