Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active)

In Stock Promotion
Code CSB-MP025141HU(M)
Abbreviation Recombinant Human TSLP protein (R127A,R130A) (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human TSLP(R127A,R130A) at 2 μg/ml can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 52.55-58.67 ng/mL. Biological Activity Assay
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of TSLP was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human TSLP(R127A,R130A) at 2 μg/mL can bind Anti-TSLP recombinant antibody(CSB-RA025141MA2HU). The EC50 is 52.55-58.67 ng/mL.
Target Names
Uniprot No.
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-159aa(R127A,R130A)
Target Protein Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Mol. Weight
16.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human TSLP Protein represents a mammalian cell-expressed variant of thymic stromal lymphopoietin engineered through arginine-to-alanine substitution site-directed mutagenesis at residues 127 and 130 within its 29-159 amino acid sequence. This lyophilized preparation demonstrates dual verification of purity exceeding 95% through both SDS-PAGE and SEC-HPLC, coupled with a C-terminal 10xHis tag that streamlines immobilized metal affinity chromatography purification. Functional validation via surface-bound interaction assays reveals its capacity to bind the anti-TSLP recombinant antibody (CSB-RA025141MA2HU) with an EC50 of 52.55-58.67 ng/mL when immobilized at 2 μg/mL, indicating preserved epitope presentation despite the arginine-to-alanine substitutions at critical positions. The mammalian expression system ensures native-like glycosylation patterns essential for proper tertiary structure formation, making this engineered TSLP variant particularly valuable for mechanistic studies requiring precise control over receptor activation thresholds and antibody neutralization assays in therapeutic development contexts.

Human TSLP is a crucial cytokine involved in various immunological processes. It is expressed in diverse human cells, including epithelial and stromal cells. It promotes type 2 immune responses [1][2]. TSLP is particularly important in the differentiation of naïve T cells into Th2 cells, which are associated with allergic responses and asthma pathology [2][3].

TSLP functions primarily through its interaction with a heterodimeric receptor complex composed of the TSLPR and the soluble sIL-7Rα. This signaling mechanism activates downstream JAK/STAT pathways, particularly involving STAT5, which is critical for the Th2 cytokine response [4]. The presence of TSLP in both healthy and diseased tissues, such as in chronic rhinosinusitis and asthma, underscores its relevance in inflammatory diseases [5][6]. In asthma, for example, elevated levels of TSLP have been observed in the airways of patients, where it is produced by bronchial epithelial cells and contributes to the recruitment and activation of immune cells like dendritic cells and mast cells [6].

Interestingly, TSLP has also been implicated in the effects of environmental factors like UV radiation and infections, which can enhance its expression through various signaling pathways [7]. For instance, exposure to respiratory syncytial virus can induce TSLP in airway epithelial cells, which further promotes an allergic type 2 response to infection [8]. Moreover, recent studies have shown that TSLP can influence the behavior of nerve cells, linking it to the sensation of itch, particularly relevant in skin conditions such as atopic dermatitis [9].

TSLP's role extends to its function as a mediator in conditions like systemic sclerosis and interstitial lung disease, driving fibrosis and highlighting its significance in chronic inflammatory diseases [10]. Additionally, the therapeutic potential of targeting TSLP in allergic diseases has been explored; monoclonal antibodies that block TSLP, such as tezepelumab, are being developed to mitigate type 2 inflammation effectively [11].

References:
[1] H. Yin, Y. Tian, R. Luo, & Y. Deng. Thymic stromal lymphopoietin is expressed in human corneal stromal cells and secreted upon protease‐activated receptor 1 activation. Iubmb Life, vol. 69, no. 8, p. 606-610, 2017. https://doi.org/10.1002/iub.1644
[2] J. Poposki, A. Klingler, et al. Proprotein convertases generate a highly functional heterodimeric form of thymic stromal lymphopoietin in humans. Journal of Allergy and Clinical Immunology, vol. 139, no. 5, p. 1559-1567.e8, 2017. https://doi.org/10.1016/j.jaci.2016.08.040
[3] K. Zhang, L. Shan, M. Rahman, H. Unruh, A. Halayko, & A. Gounni. Constitutive and inducible thymic stromal lymphopoietin expression in human airway smooth muscle cells: role in chronic obstructive pulmonary disease. Ajp Lung Cellular and Molecular Physiology, vol. 293, no. 2, p. L375-L382, 2007. https://doi.org/10.1152/ajplung.00045.2007
[4] K. Verstraete, F. Peelman, et al. Structure and antagonism of the receptor complex mediated by human tslp in allergy and asthma. Nature Communications, vol. 8, no. 1, 2017. https://doi.org/10.1038/ncomms14937
[5] D. Nagarkar, J. Poposki, et al. Thymic stromal lymphopoietin activity is increased in nasal polyps of patients with chronic rhinosinusitis. Journal of Allergy and Clinical Immunology, vol. 132, no. 3, p. 593-600.e12, 2013. https://doi.org/10.1016/j.jaci.2013.04.005
[6] H. Kabata, K. Moro, K. Fukunaga, Y. Suzuki, J. Miyata, K. Masakiet al. Thymic stromal lymphopoietin induces corticosteroid resistance in natural helper cells during airway inflammation, Nature Communications, vol. 4, no. 1, 2013. https://doi.org/10.1038/ncomms3675
[7] Y. Jang, S. Jeong, et al. Uvb induces hif-1α-dependent tslp expression via the jnk and erk pathways. Journal of Investigative Dermatology, vol. 133, no. 11, p. 2601-2608, 2013. https://doi.org/10.1038/jid.2013.203
[8] H. Lee, M. Headley, et al. Thymic stromal lymphopoietin is induced by respiratory syncytial virus–infected airway epithelial cells and promotes a type 2 response to infection. Journal of Allergy and Clinical Immunology, vol. 130, no. 5, p. 1187-1196.e5, 2012. https://doi.org/10.1016/j.jaci.2012.07.031
[9] S. Wilson, L. Thé, et al. The epithelial cell-derived atopic dermatitis cytokine tslp activates neurons to induce itch. Cell, vol. 155, no. 2, p. 285-295, 2013. https://doi.org/10.1016/j.cell.2013.08.057
[10] A. Datta, R. Alexander, et al. Evidence for a functional thymic stromal lymphopoietin signaling axis in fibrotic lung disease. The Journal of Immunology, vol. 191, no. 9, p. 4867-4879, 2013. https://doi.org/10.4049/jimmunol.1300588
[11] N. Syabbalo. Aerosol biologics for the treatment of eosinophilic asthma. Journal of Thoracic Disease and Cardiothoracic Surgery, vol. 3, no. 1, p. 01-05, 2022. https://doi.org/10.31579/2693-2156/035

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.; May act as an antimicrobial peptide in the oral cavity and on the skin.
Gene References into Functions
  1. TSLP receptor allosterically activates TSLP to potentiate the recruitment of the shared interleukin 7 receptor alpha-chain (IL-7Ralpha) by leveraging the flexibility, conformational heterogeneity and electrostatics of the cytokine. PMID: 28368013
  2. Effects of Linalyl Acetate on Thymic Stromal Lymphopoietin Production in Mast Cells. PMID: 30011850
  3. presence of epithelium-derived TSLP in the eustachian tubes plays important role in the onset of eosinophilic otitis media PMID: 29272985
  4. a new mechanism of T cell stimulation in human skin was identified, demonstrating the direct induction of T cell migration by TSLP in the absence of DCs. PMID: 28377574
  5. the secretion of TSLP by keratinocytes is induced by the HIV-1 viral synapse in a miR-375 controlled manner PMID: 28443609
  6. production increased at skin sites of ovalbumin sensitization PMID: 27992078
  7. Sera of patients with infantile eosinophilic gastroenteritis showed a specific increase in both thymic stromal lymphopoietin and IL-33 levels. PMID: 26948075
  8. short and long thymic stromal lymphopoietin isoforms have roles in house dust mite-induced asthmatic airway epithelial barrier disruption PMID: 27996052
  9. DeltaNp73 was abundantly expressed in the atopic dermatitis epidermis and increased the release of TSLP via NF-kappaB activation. PMID: 28655470
  10. this study shows that long form of thymic stromal lymphopoietin of keratinocytes is induced by protein allergens PMID: 28720058
  11. we found that activation of the protease-activated receptor 1 (PAR1) induced secretion of TSLP by the corneal stromal cells... we proposed that TSLP might function as the link between increased protease activity and inflammatory responses or itch sensation in the corneas PMID: 28631887
  12. TSLP-HOTAIR axis also plays a protective role in low-density lipoprotein (ox-LDL)-induced Endothelial cells' injury. PMID: 28615347
  13. The aim of this study was to determine the influence of human rhinovirus on the genes involved in airway remodeling and to examine the impact of TSLP and contribution of oxidative stress on airway remodeling in the context of HRV infection. PMID: 28545810
  14. TSLP-induced phosphorylation of l-plastin is increased in atopic dermatitis and increases eosinophil migration. PMID: 27304220
  15. a hit expansion exercise yielded additional active compounds that could be amenable to further optimization, providing an opportunity to dissociate TSLP inhibition from other non-desired activities. This study illustrates the potential of phenotypic drug discovery to complement target based approaches by providing new chemistry and biology leads PMID: 29320511
  16. study found that among patients with atopic dermatitis (AD), common FLG null mutations are associated with earlier AD onset in a dose-dependent manner, whereas TSLP rs1898671 appears unrelated to the timing of AD onset PMID: 28479194
  17. lactobacilli from the omnivorous group and all bifidobacteria significantly down-regulated IL-8. Notably, both genera also lowered the TSLP expression in stimulated Caco-2 cells, regardless of the diet regimen. PMID: 27863334
  18. this review focuses on recent advances on the effects of TSLP on obstetrical and gynecological diseases, including pregnancy failure, endometriosis, and cervical cancer PMID: 27976427
  19. The increase in TSLP and TNF-alpha level observed in IS fluid was found to correlate with disease severity. The increased TSLP production from asthma sputum cells was abrogated by the addition of rIL-37. Regulation of TSLP pathway may be a therapeutic approach for asthma. PMID: 27528425
  20. House dust mite sublingual immunotherapy downregulated Th2-type immune responses mediated by the TSLP-OX40L signaling pathway in patients with persistent moderate to severe allergic rhinitis. PMID: 27012942
  21. The results suggest that IL-1beta may be an early key mediator for the acquisition of an Atopic dermatitis (AD) phenotype through induction of thymic stromal lymphopoietin (TSLP) and alteration of the epidermal homeostasis. PMID: 28191908
  22. House dust mite exposure increases the expression of TSLP through PI3K/Akt signaling pathway in human bronchial epithelial 16HBE cells. PMID: 28400057
  23. Posttranslational modifications control the functional activity of TSLP in humans and overproduction of TSLP may be a key trigger for the amplification of type 2 inflammation in diseases PMID: 27744031
  24. Study provides evidence for the hypothesis that TSLP could reflect the histological severity of lumbar disc degeneration (LDD), and TSLP-siRNA and TSLPR-siRNA could inhibit apoptosis of nucleus pulposus cells. The evident information obtained from the investigation could lead the way for new therapeutic approaches regarding LDD treatment. PMID: 28746197
  25. periostin-mediated TSLP production by keratinocytes directly stimulates cutaneous T-cell lymphoma (CTCL) tumor cell growth in addition to inducing a Th2-dominant tumor environment in CTCL. PMID: 27634769
  26. this study shows that TSLP may be involved in the pathogenesis of asthma and rhinitis; dust mite and mugwort allergy could increase it significantly PMID: 28303765
  27. Serum TSLP levels were significantly increased in systemic sclerosis patients compared to healthy donors, and were associated with a higher frequency of vasculopathy. The proportion of TSLP-positive dermal cells was increased in the skin of SSc patients compared with healthy donors, and was correlated with fibrosis. PMID: 27429171
  28. this study shows that NOD2 is an asthma-related factor that can promote cell proliferation and inflammatory response by mediated expression of TSLP in human airway smooth muscle cells PMID: 27889082
  29. the effects of TSLP on myeloid cells are crucial in reducing the multiple organ failure that is associated with systemic inflammation. PMID: 26934097
  30. interactions between TSLP in follicular dendritic cells and IgA production in tonsils may be an important mechanism contributing to the pathogenesis of Immunoglobulin A (IgA) nephropathy. PMID: 27187742
  31. Study demonstrated that naturally occurring severe infections by the most common respiratory viruses in hospitalized infants induce nasal airway secretion of TSLP, IL-33, and periostin when compared with healthy controls PMID: 28471975
  32. Variations in FLG and TSLP genotype were associated with differences in self-reported skin clearance, TCI usage, and steroid usage. PMID: 27902816
  33. A possible role of TSLP in immune homeostasis in HIV infection:higher plasma TSLP was found in individuals with primary HIV infection compared to both chronic HIV infection and healthy controls. PMID: 27769179
  34. The polymorphism was further reproducibly associated with a DNA methylation signature in whole blood (P = 4.5x10-40) that also associated with allergic sensitization and expression in blood of the cytokine TSLP (P = 1.1x10-4). Knockdown of the transcription factor predicted to bind the enhancer region (NHLH1) in a human cell line (HEK293) expressing NHLH1 resulted in lower TSLP expression PMID: 27149122
  35. TSLP level was significantly higher in asthmatic than in nonasthmatic children. TSLP level was significantly different between allergic asthmatic and nonallergic nonasthmatic groups. PMID: 26999524
  36. While serum TSLP levels were unaffected by concomitant allergies and atopic comorbidities, serum levels of IL-31, IL-33 and sST2 were affected to a small extent. We found a positive correlation between TSLP, IL-31 and IL-33, and an inverse relationship between IL-33 and sST2 PMID: 27152943
  37. Results showed that TSLP promoted the production of alpha-SMA and collagen I (P<0.001), suggesting that it can accelerate MRC-5 cell fibrosis. PMID: 27385084
  38. TSLP is a key mediator in the pathogenesis of inflammatory bowel diseases and that further studies are needed to evaluate its role. [review] PMID: 27697608
  39. Letter: report decreased salivary gland TSLP expression in primary Sjogren's syndrome. PMID: 27494755
  40. A novel mouse xenograft model to study the role of TSLP-induced CRLF2 signals in normal and malignant human B lymphopoiesis has been developed. PMID: 26611474
  41. Heat stress-induced HSPs can significantly reduce the production and secretion of TSLP from keratinocytes cultured under Th2 environment. PMID: 26419317
  42. TSLP expression in the skin is mediated via RARgamma-RXR pathways. PMID: 26531761
  43. Epidermal thymic stromal lymphopoietin predicts the development of atopic dermatitis during infancy. PMID: 26879860
  44. study shows that specific food antigens can trigger innate immune mediated esophageal TSLP secretion PMID: 26992000
  45. production by monocyte-derived dendritic cells requires the integration of signals from dectin-1, the IL-1 receptor, and endoplasmic reticulum stress response stress signaling pathways PMID: 26573878
  46. The association of TSLP polymorphism rs2289278 with atopic dermatitis (AD) was stronger in children with allergic sensitization than in children without atopy, and TSLP polymorphisms also increased the risk of asthma in children with AD PMID: 26712523
  47. The positive feedback loop between TSLP, IL-33 and their receptors, and Th2 cytokines may facilitate Th2-skewed inflammation in eosinophilic CRSwNP. PMID: 26095319
  48. results show that rs1837253 polymorphism may be directly involved in the regulation of TSLP secretion. PMID: 25515628
  49. Upon TSLP stimulation, the cells with the highest TSLPR expression level showed enhanced proliferation and JAK/STAT-mediated gene regulation in a dose-dependent manner PMID: 26652578
  50. Thymic stromal lymphopoietin activation of basophils in patients with allergic asthma is IL-3 dependent PMID: 25962901

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva.
Database Links

HGNC: 30743

OMIM: 607003

KEGG: hsa:85480

STRING: 9606.ENSP00000339804

UniGene: Hs.389874

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*