Recombinant Human Toll-like receptor 7 (TLR7), partial

Code CSB-YP023606HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023606HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023606HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023606HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
PRO285; TLR 7; Tlr7; TLR7_HUMAN; Toll like receptor 7; Toll-like receptor 7; UNQ248
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Regarding your protein CSB-EP023606HU, could you please advise on the lead time, the sequencing,and the expected tag information for all 4 expression hosts?

A:
Thanks for your inquiry.
Recombinant Human Toll-like receptor 7(TLR7) ,partial
CSB-YP023606HU >> Yeast
CSB-EP023606HU >> E.coli
CSB-BP023606HU >> Baculovirus
CSB-MP023606HU >> Mammalian cell
Expression Region: 861-1049aa; Partial, provide the complete cytoplasmic domain.
Tag information:EP: N-terminal 10xHis-tagged and C-terminal Myc-tagged; YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for other expression system: YP: N-terminal 6xHis-tagged; BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV

Q:

Thank you very much for this information.
Do you have the same sequence for the cytoplasmic domain in the mouse TLR7?

A:
We can provide the same sequence for the cytoplasmic domain in the mouse TLR7, pls check the details as below:
Recombinant Mouse Toll-like receptor 7(Tlr7) ,partial
CSB-YP023606MO1 >> Yeast
CSB-EP023606MO1 >> E.coli
CSB-BP023606MO1 >> Baculovirus
CSB-MP023606MO1 >> Mammalian cell
Expression Region: 859-1050aa; Partial, provide the complete cytoplasmic domain.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

TTSHLFFWDMWYIYYFWKAKIKGYQHLQSMESCYDAFIVYDTKNSAVTEWVLQELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTQKYAKTESFKMAFYLSHQRLLDEKVDVIILIFLEKPLQKSKFLQLRKRLCRSSVLEWPANPQAHPYFWQCLKNALTTDNHVAYSQMFKETV


Reference: https://www.uniprot.org/uniprot/P58681

In addition, we have developed another region of this protein, pls check the below information for your reference:
Recombinant Mouse Toll-like receptor 7(Tlr7),partial
CSB-YP023606MO >> Yeast
CSB-EP023606MO >> E.coli
CSB-EP023606MOb1 >> E.coli
CSB-BP023606MO >> Baculovirus
CSB-MP023606MO >> Mammalian cell
Expression Region: 27-348aa; Provide the fragment of the extracellular domain at the N-terminal.
Tag information:CSB-EP023606MO: N-terminal GST-tagged; CSB-EP023606MOb1: N-terminal 10xHis-tagged and C-terminal Myc-tagged;
MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged
The expected tag for other expression system: YP: N-terminal 6xHis-tagged; BP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Target Background

Function
Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce proinflammatory cytokines and interferons, respectively.
Gene References into Functions
  1. Enhanced TLR7 expression owing to biallelism contributes to the higher risk of developing SLE. PMID: 29374079
  2. Btk acts in the TLR7/8 pathway and mediates Ser-536 phosphorylation of p65 RelA and subsequent nuclear entry in primary human macrophages. PMID: 29567473
  3. the miRNA profile did not significantly differ between SLE and APS, but was driven by the presence or absence of an IFN signature. TLR7 stimulation induced a general downregulation of miRNAs, similar to the pattern observed in SLE and APS patients. PMID: 29873766
  4. TLR7 upregulation has a role in liver cancer cell proliferation involving lipid rafts PMID: 27588480
  5. Study demonstrates that Hepatitis C virus (HCV) genomic RNA harbours specific sequences that initiate an anti-HCV immune response through TLR7 and TLR8 in various antigen presenting cells. PMID: 27385120
  6. TLR7, TLR9, and JAK2 genes are potential biomarkers for systemic sclerosis. High TLR7 expression positively correlated with the late form of disease. Decreased levels of TLR9 and JAK2 mRNA were found in the patient's cohort in comparison to non-SSc individuals. PMID: 29147913
  7. The results indicate that TLR7 up-regulation is related to Respiratory syncytial virus infection and the induction of oxidative stress and that TLR7 expression was mediated by the anti-inflammatory effects of Nrf2/ARE pathway inhibitors or agonists. PMID: 29392496
  8. Thus, TLR7 and TLR8 might modulate different immune responses in monocytes and macrophages. PMID: 29448098
  9. Positive rates of iNOS in cervical tissues were 72.1%, 28.2%, and 3.1% in the -HPV-positive patients with cervical cancer (CC group), HR-HPV group, and controls, respectively (P < 0.05). Levels of TLR3, TLR4, TLR7, TLR8, NF-kappaB p65, and iNOS in cervical epithelial cells were higher in CC group than in other groups. PMID: 28626766
  10. Data suggest a central role of XBP1 in TLR7-induced IFNalpha production and identify XBP1 as a potential novel therapeutic target in IFNalpha-driven autoimmune and inflammatory diseases. PMID: 28408069
  11. These findings suggest that increased EV71 and CA16 replication meditated by autophagy in 16HBE cells might promote degradation of the endosome, leading to suppression of the TLR7-mediated IFN-I signaling pathway. PMID: 29052054
  12. The present study investigated the effects of vitamin D3 on the expression of TLR3, TLR7, and TLR9 in Systemic lupus erythematosus patients. PMID: 28544067
  13. findings indicate that hepatitis C virus induces CD4 T cell impairment via TLR7 which may contribute to failure of virus eradication, casting doubts on the use of TLR7 agonists to boost innate immunity in chronic RNA virus infections. PMID: 27876497
  14. TLR 5, 7, and 9 expression patterns differed between HPV-positive and -negative oropharyngeal squamous cell carcinoma patients. In HPV-positive tumors the expression of TLR 5 and 7 correlated with tumor recurrence. PMID: 28856441
  15. Low TLR7 copy number is a risk factor for chronic hepatitis B virus infection but is not associated with later stages of disease progression PMID: 28321161
  16. TLR7 and TLR8 genetic polymorphisms are associated with susceptibility to mycobacterium tuberculosis infection, and the link is shaped by less effective MTB phagocytosis and impaired TLR signaling. PMID: 27156628
  17. Study evaluated innate immune profiles following TLR stimulation in HIV-1-infected mothers and newborns, found significantly compromised cytokine responses upon extracellular and intracellular TLR activation. Myeloid dendritic cell (DC) responsiveness appeared to be less impaired than plasmacytoid DCs, and might be enhanced through TLR7/TLR8 activation. PMID: 23826189
  18. This is the first study illustrating certain genotypes of TLR-7 and TLR-8 single nucleotide polymorphisms viz. CT(p = 0.002)]; rs3853839[GC(p < 0.001), CC(p = 0.039)] and rs3764879[GC(p < 0.001)] were considerably associated with Chikungunya virus susceptibility. PMID: 28888110
  19. study demonstrates that activation of TLR7 signaling in T cells can inhibit Th17 cell differentiation from naive T cells and IL-17 production in established Th17 cells; further report that downregulation of STAT3 signaling is responsible for TLR7-mediated inhibition of Th17 cells due to induction of suppressor of cytokine signaling 3 and 5 PMID: 28652396
  20. Data indicate a mechanism in which Toll-like receptors TLR7/8 signaling, through shedding of FcgRIIA, shifts neutrophil function from phagocytosis to a programmed necrosis pathway, neutrophil extracellular trap formation (NETosis). PMID: 28606989
  21. TLR7 is abundantly expressed in human atherosclerotic plaques. TLR7 ligation elicits the secretion of pro-inflammatory and anti-inflammatory cytokines, and high TLR7 expression in plaques is associated with better patient outcome. PMID: 27864310
  22. this study identified TLR7 as mediator of monocyte differentiation and M2 macrophage polarization during hepatitis C virus infection PMID: 28122964
  23. Increased susceptibility to autoimmune is associated with single nucleotide polymorphisms and copy number variations of Toll like receptor 7. [review] PMID: 28397237
  24. COPD lung tissue explants showed a greater pro-inflammatory response to TLR3 or TLR7/8 activation than control smokers. PMID: 27729782
  25. the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID: 26144250
  26. TLR9 and TLR7 were upregulated both at the mRNA and the protein levels in wounds of type 2 diabetes mellitus patients compared with the non-diabetic patients and may lead to an unresolved inflammatory response and non-healing chronic ulcers. PMID: 25586463
  27. This study suggests that deliberate control of TLR signaling is a key factor in the success of mRNA-driven cellular reprogramming. PMID: 27586271
  28. changes in mRNA expression of selected toll-like receptors (TLR2, TLR4, TLR7), stress cytokine prolactin (PRL), and proand anti-inflammatory cytokines (TNF-alpha, IL-6, IL-12, IL-10) in peripheral blood monocytes of celiac disease patients, were investiagted. PMID: 28028951
  29. The ER-stress inducing property of IMQ is possibly of importance for its efficacy in treating basal cell carcinoma, in situ melanoma, and squamous cell carcinoma. Our data could potentially be harnessed for rational design of even more potent ER-stress inducers and new anti-cancer drugs. PMID: 27003259
  30. TLR8 polymorphisms were associated with an increased risk and TLR7 polymorphisms with a decreased risk of recurrent rhinovirus infections. PMID: 28403045
  31. We found lower expression levels of TLR1, TLR3, TLR4, TLR7 and TLR9 in PBMCs from patients with ALL compared with those from control patients. We also observed that the PBMCs from patients with Pre-B and B ALL had lower TLR4 expression than controls PMID: 27277333
  32. interferon alpha (IFN-alpha) secretion induced by Toll-like receptor 7 and Toll-like receptor 8 (TLR7/TLR8) activation was observed in common variable immunodeficiency (CVID), which was recovered with Toll-like receptor 9 (TLR9) signaling. PMID: 27392462
  33. this study shows that TLR7 gene polymorphism is associated with susceptibility to HIV and HCV co-infection PMID: 28062211
  34. TLR7 gene rs2897827 may influence TLR7 mRNA expression and the plasma ApoA1 level in male ischemic stroke patients. PMID: 27427388
  35. Considering that chronic hepatitis B infection is not yet curable, it could be possible to activate TLR7-related immunological pathways as a therapy directed towards persistent HBV infection PMID: 27373425
  36. Both TLR 5 and 7 are expressed in salivary adenoid cystic carcinoma on the cell membranes as well as in cytoplasm. PMID: 26888781
  37. human Toll-like receptor 7 ligand binding domain PMID: 25817271
  38. TLR7 mRNA expression was significantly elevated in patients with relapsing remitting multiple sclerosis. PMID: 26996115
  39. Our meta-analysis suggests that TLR7, TLR8, and TLR9 polymorphisms are associated with the development of systemic lupus erythematosus in Caucasian, Asian, and African populations PMID: 26762473
  40. activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min. PMID: 26718740
  41. Increased expression of TLR7 and TLR9 in myasthenia gravis thymus is accompanied by active Epstein-Barr virus infection. PMID: 26723518
  42. The low expression of TLR-7 in tumour and high expression of TLR-7 in stroma predict a good clinical outcome for oral squamous cell carcinoma patients PMID: 25828894
  43. TLR7 and 8 polymorphisms may play a considerable role in the pathogenesis of asthma. PMID: 26725554
  44. NADPH oxidase-deficient patient-derived B cells also expressed enhanced levels of TLR7 and TLR9 mRNA and protein compared with the same cells reconstituted to restore oxidase activity. PMID: 26340429
  45. Data show that differences in codon bias limit Toll-like receptor 7 (TLR7) expression relative to Toll-like receptor 9 (TLR9). PMID: 26903634
  46. Activation of TLR7 suppresses the progression of pancreatic cancer. PMID: 26238718
  47. Results show that TLR7 and TLR8 on trophoblastic cells play an important role in the prevention of intrauterine HBV transmission by inhibiting HBV translocation across trophoblasts. PMID: 26315138
  48. In females, the incidence of the X-linked TLR7 rs179008/Gln11Leu polymorphism was significantly lower in sarcoidosis patients. PMID: 24071890
  49. A key regulatory cytokine found increased upon TLR7 stimulation. PMID: 25923141
  50. This study established a correlation between miR-155 and TLR7 during hepatitis B virus infection and also demonstrated in vitro that increased miR-155 level could help to reduce viral load by targeting C/EBP-beta. PMID: 25720442

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endosome. Lysosome. Cytoplasmic vesicle, phagosome.
Protein Families
Toll-like receptor family
Tissue Specificity
Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells. Expressed in peripheral mononuclear blood cells.
Database Links

HGNC: 15631

OMIM: 300365

KEGG: hsa:51284

STRING: 9606.ENSP00000370034

UniGene: Hs.659215

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1