Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
PRO285; TLR 7; Tlr7; TLR7_HUMAN; Toll like receptor 7; Toll-like receptor 7; UNQ248
Species
Homo sapiens (Human)
Expression Region
861-1049aa
Target Protein Sequence
HLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTKDPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 861-1049 form the expressed segment for recombinant Human TLR7. The expected molecular weight for the TLR7 protein is calculated to be 29.5 kDa. This TLR7 recombinant protein is manufactured in e.coli. The TLR7 coding gene included the N-terminal 10xHis tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant TLR7 protein in following stages of expression and purification.
Toll-like receptor 7 (TLR7) is a critical component of the innate immune system, belonging to the Toll-like receptor (TLR) family. TLR7 is predominantly expressed in immune cells, such as dendritic cells and macrophages, and is located within endosomal compartments. It plays a key role in recognizing single-stranded RNA from viruses. Upon binding to its ligands, TLR7 activates signaling pathways that involve the adaptor protein MyD88, leading to the activation of transcription factors like NF-κB and the production of pro-inflammatory cytokines, interferons, and other immune mediators. TLR7 is especially important in antiviral responses, contributing to the host defense against viral infections. Research on TLR7 aims to elucidate its signaling cascades, identify specific ligands, and understand its role in various diseases. Additionally, TLR7 agonists are explored for their potential in vaccine development and immunotherapy against viral infections and certain cancers.
