Recombinant Human Elongin-B (ELOB)

In Stock
Code CSB-EP620878HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ELOB
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
EloB; ELOB_HUMAN; Elongin 18 kDa subunit; Elongin B; Elongin-B; RNA polymerase II transcription factor SIII p18 subunit; RNA polymerase II transcription factor SIII subunit B; SIII; SIII p18; TCEB 2; Tceb2; Transcription elongation factor B (SIII) polypeptide 2; Transcription elongation factor B polypeptide 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-118aa
Target Protein Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.1kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human ELOB covers amino acids 1-118. The expected molecular weight for the ELOB protein is calculated to be 40.1 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal GST tag into the ELOB encoding gene fragment was conducted, allowing for easier detection and purification of the ELOB protein in subsequent stages.

The human Elongin B (ELOB) protein is a subunit of the Elongin complex, critical for RNA polymerase II transcription elongation. ELOB, along with Elongin C and Elongin A, forms a scaffold that interacts with transcription factors and regulates gene expression. In cancer research, ELOB is implicated in tumor development and progression, acting as a potential prognostic marker. Studying ELOB provides insights into transcriptional control mechanisms. Additionally, ELOB plays a role in viral replication, making it relevant in virology. Investigating ELOB's diverse functions enhances our understanding of transcriptional regulation, offering potential applications in cancer diagnostics, therapeutics, and antiviral strategies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you make a complex protein of VHL, Elongin B in cusabio?

A:
Thanks for your inquiry. As to your question about the complex protein VCB (VHL complex with Elongin B protein), sorry, we can't provide the complex protein,but we can provide the monomer protein separately. Probably you can purchase these monomer proteins and make the complex protein by yourself.
Please check information as follows:
Elongin B:
Reference:http://www.uniprot.org/uniprot/Q15370
Recombinant Human Transcription elongation factor B polypeptide 2(TCEB2)
CSB-EP620878HU >> E.coli
Expression region: 1-118aa; Full length.
Tag information:N-terminal GST-tagged.
Sequence:

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ


Target Background

Function
SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). In embryonic stem cells, the elongin BC complex is recruited by EPOP to Polycomb group (PcG) target genes in order generate genomic region that display both active and repressive chromatin properties, an important feature of pluripotent stem cells.; Core component of multiple cullin-RING-based ECS (ElonginB/C-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of target proteins. This includes the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes. A number of ECS complexes (containing either KLHDC2, KLHDC3, KLHDC10, APPBP2, FEM1A, FEM1B or FEM1C as substrate-recognition component) are part of the DesCEND (destruction via C-end degrons) pathway, which recognizes a C-degron located at the extreme C terminus of target proteins, leading to their ubiquitination and degradation.
Gene References into Functions
  1. Study shows that TCEB2 is involved in the development of acquired resistance to bevacizumab in ovarian cancer cells via the mechanisms of suppression of VEGF-A expression by promoting HIF-1alpha degradation and induction of interleukin-8 (IL-8) expression. PMID: 26531153
  2. Elongin B also enhances gene expression from the double-stranded DNA genome of human cytomegalovirus. PMID: 21447700
  3. nuclear level of active P-TEFb is controlled by dynamic and reversible remodelling of 7SK snRNP PMID: 17611602
Subcellular Location
Nucleus.
Database Links

HGNC: 11619

OMIM: 600787

KEGG: hsa:6923

STRING: 9606.ENSP00000262306

UniGene: Hs.172772

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*