Code | CSB-EP620878HU |
Abbreviation | Recombinant Human ELOB protein |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The expression region of this recombinant Human ELOB covers amino acids 1-118. The expected molecular weight for the ELOB protein is calculated to be 40.1 kDa. This protein is generated in a e.coli-based system. Fusion of the N-terminal GST tag into the ELOB encoding gene fragment was conducted, allowing for easier detection and purification of the ELOB protein in subsequent stages.
The human Elongin B (ELOB) protein is a subunit of the Elongin complex, critical for RNA polymerase II transcription elongation. ELOB, along with Elongin C and Elongin A, forms a scaffold that interacts with transcription factors and regulates gene expression. In cancer research, ELOB is implicated in tumor development and progression, acting as a potential prognostic marker. Studying ELOB provides insights into transcriptional control mechanisms. Additionally, ELOB plays a role in viral replication, making it relevant in virology. Investigating ELOB's diverse functions enhances our understanding of transcriptional regulation, offering potential applications in cancer diagnostics, therapeutics, and antiviral strategies.There are currently no reviews for this product.
Can you make a complex protein of VHL, Elongin B in cusabio?
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ