Recombinant Human Trypsin-2 (PRSS2)

Code CSB-EP018814HU
Abbreviation Recombinant Human PRSS2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PRSS2
Uniprot No.
Research Area
Cell Biology
Alternative Names
Anionic trypsinogen;Serine protease 2;Trypsin II
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-247aa
Target Protein Sequence
IVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
In the ileum, may be involved in defensin processing, including DEFA5.
Gene References into Functions
  1. evaluated the association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute (RAP) and chronic pancreatitis PMID: 26110235
  2. PRSS2 single nucleotide polymorphism associated with the development of alcoholic pancreatitis. PMID: 25253127
  3. Serum trypsinogen-2 is associated with pancreatic cancer and pancreatitis. PMID: 25916077
  4. trypsin-2 over-expression enhanced tongue carcinoma cell invasion by various genetic and proteolytic mechanisms. PMID: 22909050
  5. Elevation of urine trypsinogen 2 is an independent risk factor for pancreatic fistula after pancreaticoduodenectomy. PMID: 22357509
  6. Report a simple, rapid, easy, and noninvasive urinary trypsinogen-2 test can diagnose or rule out most cases of acute pancreatitis. PMID: 22481290
  7. Data show that urinary trypsinogen-2 dipstick test is a useful test for early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis. PMID: 21946810
  8. results suggest that trypsinogen-2 is a more sensitive marker than amylase, and it can be useful in early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis. PMID: 21792081
  9. A genetic variant of PRSS2 may contribute to the low prevalence of pancreatitis in primary hyperparathyroidism patients. PMID: 20625975
  10. Hyperexpression of the PRSS2 gene is associated with pancreatic cancer. PMID: 20428826
  11. there was a borderline statistically significant association between pancreatic cancer and HAT/HCT but no association between pancreatic cancer and HAT, HCT. PMID: 20484960
  12. Urine trypsinogen-2 test may be an important diagnostic tool in excluding the diagnosis of acute pancreatitis; it has a negative predictive value. PMID: 20517765
  13. Results do not support the urinary trypsinogen-2 dipstick test (UTDT) to replace standard plasma amylase for the diagnosis of AP, however, the test demonstrated an adequate sensitivity to be used for rapid early screening of AP in daily clinics. PMID: 19752771
  14. Results indicate that up-regulation of anionic trypsinogen in pancreatic diseases does not affect physiological trypsinogen activation, but significantly limits trypsin generation under potential pathological conditions. PMID: 12709065
  15. High levels of pulmonary trypsin-2 may be associated with the development of bronchopulmonary dysplasia in preterm infants. PMID: 12949286
  16. G191R variant of PRSS2 mitigates intrapancreatic trypsin activity and thereby protects against chronic pancreatitis PMID: 16699518
  17. Our results suggest that serum trypsinogen-2 is a most useful marker for diagnosing patients with cholangiocarcinoma, and it is superior to serum CA19-9 and CEA. PMID: 17640760
  18. Co-localization of trypsin-2 and MMP-9 resulted in intracellular proMMP-9 processing that represented fully or partially activated MMP-9. PMID: 18062964
  19. A loss of function polymorphism (G191R) of anionic trypsinogen (PRSS2) confers protection against chronic pancreatitis. PMID: 18362849
  20. A fusion with PRSS1 is associated with hereditary pancreatitis. PMID: 18461367
  21. primary role of trypsinogen sulfation in humans is to stimulate autoactivation of PRSS1 PMID: 18986305
  22. The p.G191R variant protected against alcoholic and idiopathic chronic pancreatitis as well as alcoholic acute pancreatitis in Japan. PMID: 19052022
  23. G191R PRSS2 is a rare allele in the Indian population and the data suggest a nonsignificant trend towards a protective effect from tropical calcific pancreatitis in Indians. PMID: 19077465

Show More

Hide All

Subcellular Location
Secreted, extracellular space.
Protein Families
Peptidase S1 family
Tissue Specificity
Expressed in Paneth cells, at the base of small intestinal crypts.
Database Links

HGNC: 9483

OMIM: 601564

KEGG: hsa:5645

UniGene: Hs.449281

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*