Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PRSS2

Uniprot No.

P07478

Research Area

Cell Biology

Alternative Names

(Anionic trypsinogen)(Serine protease 2)(Trypsin II)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

16-247aa(K23Q,S167G)

Target Protein Sequence

APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.4 kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human PRSS2 is an essential research tool for those working in the field of Cell Biology. It is expressed in the E.coli system and spans the 16-247aa region of Trypsin-2 (Anionic trypsinogen; Serine protease 2; Trypsin II) and features the K23Q and S167G mutations. To facilitate purification and detection, an N-terminal GST-tag has been incorporated, ensuring a consistently high-quality product for your experiments.

Our Recombinant Human PRSS2 protein exhibits a purity greater than 90%, as determined by SDS-PAGE, and is available in both liquid and lyophilized powder forms. Rely on this exceptional protein to support your Cell Biology research, delivering consistent and outstanding results.

Code	CSB-EP018814HU(M)e0
Abbreviation	Recombinant Human PRSS2 protein (K23Q,S167G), partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Trypsin-2 (PRSS2) (K23Q,S167G), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage