Recombinant Human Tumor necrosis factor ligand superfamily member 12 (TNFSF12), partial (Active)

In Stock
Code CSB-MP023987HU1
Abbreviation Recombinant Human TNFSF12 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg/ml can bind Human TNFRSF12A (CSB-MP873605HU). The EC50 is 0.7706-0.9123 ng/mL. Biological Activity Assay
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg/ml can bind Anti-TNFSF12 recombinant antibody (CSB-RA023987MA1HU). The EC50 is 2.862-3.195 ng/mL. Biological Activity Assay
  • Activity
    Human TNFRSF12A (CSB-MP873605HU) captured on Protein A Chip can bind Recombinant Human TNFSF12 with an affinity constant of 0.154 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
  • Activity
    TNFSF12 Recombinant Monoclonal Antibody (CSB-RA023987MA1HU) captured on Protein A Chip can bind Recombinant Human TNFSF12 with an affinity constant of 0.205 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg/mL can bind Human TNFRSF12A (CSB-MP873605HU). The EC50 is 0.7706-0.9123 ng/mL.
②Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 at 2 μg/mL can bind Anti-TNFSF12 recombinant antibody (CSB-RA023987MA1HU). The EC50 is 2.862-3.195 ng/mL.
③Human TNFRSF12A (CSB-MP873605HU) captured on Protein A Chip can bind Recombinant Human TNFSF12 with an affinity constant of 0.154 nM as detected by MetaSPR Assay (WeSPRTM 200).
④TNFSF12 Recombinant Monoclonal Antibody (CSB-RA023987MA1HU) captured on Protein A Chip can bind Recombinant Human TNFSF12 with an affinity constant of 0.205 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor ligand superfamily member 12; APO3 ligand; TNF-related weak inducer of apoptosis; TWEAK [Cleaved into: Tumor necrosis factor ligand superfamily member 12, membrane form; Tumor necrosis factor ligand superfamily member 12, secreted form]
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
94-249aa
Target Protein Sequence
SAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Mol. Weight
21.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.
Gene References into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
  2. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086
Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als
Database Links

HGNC: 11927

OMIM: 602695

KEGG: hsa:407977

UniGene: Hs.54673

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*