Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Code | CSB-EP023987HU |
Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | TNFSF12 |
Uniprot No. | O43508 |
Research Area | Cancer |
Alternative Names | APO 3 ligand; APO 3L; APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; MGC129581; MGC20669; secreted form; TNF-related weak inducer of apoptosis; TNF12_HUMAN; TNFSF 12; Tnfsf12; TNFSF12 protein; Tumor necrosis factor (ligand) superfamily member 12; Tumor necrosis factor ligand superfamily member 12; Tumor necrosis factor superfamily member 12; TWEAK; UNQ181/PRO207 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 43-249aa |
Target Protein Sequence | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 38.9 kDa |
Protein Length | Extracellular Domain |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein. |
Protein Families | Tumor necrosis factor family |
Tissue Specificity | Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als |
Database Links |
HGNC: 11927 OMIM: 602695 KEGG: hsa:407977 UniGene: Hs.54673 |