Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15),partial,Biotinylated (Active)

In Stock
Code CSB-MP023992HU1-B
Abbreviation Recombinant Human TNFSF15 protein, partial, Biotinylated (Active)
MSDS
Size $338
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/ml on streptavidin coated plates can bind Anti-TNFSF15 antibody (CSB-RA023992MA1HU). The EC50 is 0.2732 - 0.6370 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody (CSB-RA023992MA1HU). The EC50 is 0.2732 - 0.6370 ng/mL.
Target Names
Uniprot No.
Alternative Names
TL1, VEGI
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
72-251aa
Target Protein Sequence
LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Mol. Weight
25.4 kDa
Protein Length
Partial of Isoform 1
Tag Info
N-terminal 10xHis-Avi-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human TNFSF15 protein, covering residues 72-251, is generated through plasmid expression in mammalian cells. The plasmid is formed by inserting the gene segment that codes for the 72-251aa of the human TNFSF15. The gene segment is co-expressed with the N-terminal 10xHis-Avi-tag gene. The resulting TNFSF15 protein's purity is greater than 95% as accessed by SDS-PAGE. Its endotoxin content is measured to be below 1.0 EU/μg using the LAL assay. ELISA demonstrates the TNFSF15 protein's biological functionality, with specific TNFSF15 antibody (CSB-RA023992MA1HU) binding yielding an EC50 range of 0.2732 to 0.6370 ng/mL.

Human TNFSF15 (TL1A or VEGI) is a member of the TNF superfamily, with a multifaceted role in immune regulation, inflammation, and angiogenesis. TNFSF15 is primarily expressed in immune cells such as macrophages and T cells, and its expression can be induced by pro-inflammatory stimuli [1][2]. This cytokine is particularly notable for its involvement in the modulation of T-helper cell responses, especially in promoting the differentiation of Th17 cells, which are crucial in various inflammatory and autoimmune conditions [1][3][4].

TNFSF15 has been shown to inhibit angiogenesis by regulating endothelial cell proliferation and survival. It achieves this by downregulating the VEGF production and promoting apoptosis in vascular endothelial cells [2][5]. This anti-angiogenic property is significant in the context of cancer, where TNFSF15 can limit tumor growth by preventing the formation of new blood vessels [2][6]. Moreover, TNFSF15 has been implicated in various pathological conditions, including inflammatory bowel disease (IBD), where it may contribute to gut inflammation and fibrosis [3][7][8].

Recent studies have also highlighted the role of TNFSF15 in immune responses beyond inflammation. TNFSF15 has been shown to facilitate the differentiation of myeloid cells into vascular pericytes in tumors, enhancing their ability to associate with endothelial cells [9]. This suggests that TNFSF15 may have a dual role in both promoting and regulating immune responses, depending on the context [3][4]. Additionally, genetic variants of TNFSF15 have been associated with susceptibility to various diseases, including spondyloarthritis and gastric cancer, indicating its potential as a biomarker for disease risk [10][11][12].

References:
[1] M. Zucchelli, M. Camilleri, A. Andréasson, F. Bresso, A. Dlugosz, J. Halfvarson, et al. Association of tnfsf15 polymorphism with irritable bowel syndrome, Gut, vol. 60, no. 12, p. 1671-1677, 2011. https://doi.org/10.1136/gut.2011.241877
[2] P. Liang, F. Tian, Y. Lü, B. Duan, D. Stolz, & L. Li. Vascular endothelial growth inhibitor (vegi; tnfsf15) inhibits bone marrow-derived endothelial progenitor cell incorporation into lewis lung carcinoma tumors, Angiogenesis, vol. 14, no. 1, p. 61-68, 2010. https://doi.org/10.1007/s10456-010-9195-8
[3] A. Richard, J. Peters, N. Savinykh, J. Lee, E. Hawley, F. Meylan, et al. Reduced monocyte and macrophage tnfsf15/tl1a expression is associated with susceptibility to inflammatory bowel disease, Plos Genetics, vol. 14, no. 9, p. e1007458, 2018. https://doi.org/10.1371/journal.pgen.1007458
[4] J. You, J. Bian, J. Chen, T. Xia, A. Deng, M. Zhang, et al. Tnfsf15 and mia variant associated with immunotherapy and prognostic evaluation in esophageal cancer, Journal of Oncology, vol. 2023, p. 1-12, 2023. https://doi.org/10.1155/2023/1248024
[5] K. Zhang, H. Cai, S. Gao, G. Yang, H. Deng, G. Xu, et al. Tnfsf15 suppresses vegf production in endothelial cells by stimulating mir-29b expressionviaactivation of jnk-gata3 signals, Oncotarget, vol. 7, no. 43, p. 69436-69449, 2016. https://doi.org/10.18632/oncotarget.11683
[6] T. Qin, D. Huang, Z. Liu, Y. Jia, X. Chen, & K. Li. Tumor necrosis factor superfamily 15 promotes lymphatic metastasis via upregulation of vascular endothelial growth factor‐c in a mouse model of lung cancer, Cancer Science, vol. 109, no. 8, p. 2469-2478, 2018. https://doi.org/10.1111/cas.13665
[7] A. El‐Asrar, G. Hertogh, M. Nawaz, M. Siddiquei, K. Eynde, G. Mohammad, et al. The tumor necrosis factor superfamily members tweak, tnfsf15 and fibroblast growth factor-inducible protein 14 are upregulated in proliferative diabetic retinopathy, Ophthalmic Research, vol. 53, no. 3, p. 122-130, 2015. https://doi.org/10.1159/000369300
[8] D. Shih, R. Barrett, X. Zhang, N. Yeager, H. Koon, P. Phaosawasdi, et al. Constitutive tl1a (tnfsf15) expression on lymphoid or myeloid cells leads to mild intestinal inflammation and fibrosis, Plos One, vol. 6, no. 1, p. e16090, 2011. https://doi.org/10.1371/journal.pone.0016090
[9] X. Gu. Tnfsf15 facilitates the differentiation of cd11b+ myeloid cells into vascular pericytes in tumors, Cancer Biology and Medicine, p. 1-16, 2023. https://doi.org/10.20892/j.issn.2095-3941.2023.0245
[10] E. Zinovieva, C. Bourgain, A. Kadi, F. Letourneur, B. Izac, R. Said‐Nahal, et al. Comprehensive linkage and association analyses identify haplotype, near to the tnfsf15 gene, significantly associated with spondyloarthritis, Plos Genetics, vol. 5, no. 6, p. e1000528, 2009. https://doi.org/10.1371/journal.pgen.1000528
[11] Z. Zhi, D. Yu, J. Lu, K. Zhai, L. Cao, J. Rao, et al. Functional genetic variants of tnfsf15 and their association with gastric adenocarcinoma: a case-control study, Plos One, vol. 9, no. 9, p. e108321, 2014. https://doi.org/10.1371/journal.pone.0108321
[12] H. Gao, Z. Niu, Z. Zhang, H. Wu, Y. Xie, Z. Yang, et al. Tnfsf15 promoter polymorphisms increase the susceptibility to small cell lung cancer: a case-control study, BMC Medical Genetics, vol. 20, no. 1, 2019. https://doi.org/10.1186/s12881-019-0762-6

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
Gene References into Functions
  1. TNFSF15 polymorphisms may contribute to genetic susceptibility of inflammatory bowel disease (Meta-Analysis) PMID: 29873318
  2. TL1A modulated Rheumatoid arthritis-fibroblast-like synoviocytes migration and Indian hedgehog signaling pathway using TNFR2. PMID: 29748156
  3. TL1A can induce tumor cell proliferation and promote the occurrence of colitis-associated colorectal cancer by activating Wnt/beta-catenin pathway. PMID: 29796912
  4. TNFSF15, a cytokine mainly produced by blood endothelial cells, facilitates tumor lymphangiogenesis by upregulating VEGFC expression in A549 cells. PMID: 29890027
  5. Results suggested that TNFSF15 (rs3810936 and rs4979462) SNPs may confer susceptibility to systemic lupus erythematosus (SLE) risk, which were significantly associated with the clinical phenotypes of SLE. PMID: 29803925
  6. Three alternatively spliced isoforms of VEGI, VEGI174, VEGI192 and VEGI251 have been documented. This study investigated the effects of VEGI174 and its functional domains (V7 and V8) on epithelialmesenchymal transition (EMT) in renal cell carcinoma (RCC) cells in vitro. Overexpression of VEGI174, V7 or V8 inhibited EMT. PMID: 28656288
  7. Results provide evidence that variance within TNFSF15 has the potential to affect cytokine expression across a range of tissues and thereby contribute to protection from infectious diseases such as leprosy, while increasing the risk of immune-mediated diseases including Crohn's disease and primary biliary cholangitis. PMID: 27507062
  8. single variant analysis detected a previously unreported psoriasis risk locus at TNFSF15 (rs6478108) PMID: 28973304
  9. play a role in the development of systemic sclerosis PMID: 28397078
  10. the DR3/TL1A pathway directly enhances human OC formation and resorptive activity, controlling expression and activation of CCL3 and MMP-9. PMID: 28062298
  11. the blocking of tumor necrosis factor receptor 2 (TNFR2) decreased TL1A-stimulated IL-6 production by rheumatoid arthritis fibroblast-like synoviocytes. PMID: 27081759
  12. Distinct but overlapping TNFSF15 haplotypes were demonstrated in diverticulitis patients versus healthy controls when compared with the known Crohn's risk haplotype suggesting similar but distinct genetic predispositions. This study strengthens the role for a genetic predisposition to diverticulitis that involves the TNFSF15 gene. PMID: 28624054
  13. TL1A differentially induces expression of TH17 effector cytokines IL-17, -9, and -22 and provides a potential target for therapeutic intervention in TH17-driven chronic inflammatory diseases. PMID: 27733581
  14. Our findings indicate that VEGI174 prevents progression and tumor metastasis through inhibiting epithelial-mesenchymal transition (EMT) in renal cell carcinoma (RCC) in vivo. This may provide a new approach for the treatment of RCC PMID: 28739718
  15. Data suggest that human regulatory T-lymphocytes express DR3 and demonstrate DR3/TL1A-mediated activation of signaling via MAP kinases and NFkappaB. (DR3 = death receptor 3; TL1A/TNFSF15 = tumor necrosis factor [ligand] superfamily, member 15) PMID: 28337757
  16. These results raise the possibility for involvement of TL1A/DR3/DR3-mediated mechanisms in epithelial-mesenchymal interactions and the development of inflammation-induced intestinal fibrosis in Crohn's disease. PMID: 27665176
  17. rs1250569 (ZMIZ1) and rs10114470 (TL1A) are two novel loci that indicate susceptibility to Inflammatory Bowel Disease in Han-Chinese patients. PMID: 28456797
  18. results support an idea that the genetic susceptibility of TNFSF15 to CD may be confounded, in part, by the increase of Prevotella PMID: 28197769
  19. (188)Re-NGR-VEGI has the potential as a theranostic agent. PMID: 26768609
  20. miRNA-31 can directly bind to the 3-UTR of TNFSF15, thereafter negatively regulating its expression in Caco2 cells. PMID: 27188743
  21. There were significant associations of rs3810936, rs6478108, rs6478109, rs7848647 with CD in Korean pediatric patients (P = 6.5x10(-8), P = 1.3x10(-8), P = 3.7x10(-8), P = 2.9x10(-8), respectively). PMID: 25998826
  22. Patients with mild traumatic brain injury (TBI) exhibited higher VEGI levels than those with moderate and severe TBI. PMID: 26945876
  23. Biologics beyond TNF-alpha inhibitors and the effect of targeting the homologues TL1A-DR3 pathway in chronic inflammatory disorders. PMID: 26810853
  24. Rs3810936 of TNFSF15 were related to the risk of ankylosing spondylitis PMID: 26823868
  25. Higher TL1A levels were associated with early stage chronic lymphocytic leukemia. PMID: 26393680
  26. TL1A-induced cell death is directly mediated through DR3. PMID: 26509650
  27. Plasma levels of TL1A were significantly higher in newly diagnosed SLE patients compared with controls, and were positively associated with SLE disease activity index. PMID: 25929716
  28. This study indicates that the HDAC inhibitor may be exploited as a therapeutic strategy modulating the soluble VEGI/DR3 pathway in osteosarcoma patients PMID: 25778932
  29. Results show that subjects with TNFSF15 -358CC genotype were at higher risks for developing gastric adenocarcinoma in the Helicobacter pylori infected group. PMID: 25251497
  30. The data indicate that TL1A may contribute to pathogenesis of inflammatory bowel diseases via local but not systemic induction of IL-17A but not IL-4, IL-13 or IFN-gamma. PMID: 26072972
  31. study has defined the increased serum and SF samples levels of TL1A and DcR3 in patients with rheumatoid arthritis (RA); findings support the hypothesis that TL1A and DcR3 may contribute to the pathogenesis of RA PMID: 25647275
  32. TNFSF15 SNPs, rs6478108 and rs4574921, may be independent genetic predictive factors for the development of stricture/non-perianal penetrating complications and perianal fistula, respectively. PMID: 24835165
  33. TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID: 25148371
  34. Addition of TL1A to IL-1beta + IL-23 also augmented ILC3 proliferation PMID: 26046454
  35. This study shows an association between TNFSF15-rs3810936 and AAU and suggests that the TL1A/DR3 pathway may be implicated in the pathogenesis of this disease. PMID: 26200500
  36. associations exist between TNFSF15 gene polymorphisms and IBD (both CD and UC) in the Indian population PMID: 25501099
  37. These results suggested that TL1A could promote Th17 differentiation in rheumatoid arthritis via the activation of RORc, and this effect may be mediated by the binding of TL1A with DR3. PMID: 24832108
  38. TL1A blood levels are elevated in psoriasis patients; TL1A expression is higher in psoriatic lesions than in normal skin PMID: 25908025
  39. Human primary biliary cirrhosis-susceptible allele of rs4979462 enhances TNFSF15 expression by binding NF-1. PMID: 25899471
  40. Soluble TL1A synergized with IL-23 to stimulate peripheral blood mononuclear cells from patients with psoriasis vulgaris to produce IL-17. PMID: 25200589
  41. This meta-analysis indicated that most of the seven TNFSF15 polymorphisms (except for rs4263839) were risk factors contributed to CD and UC susceptibility. The differences in ethnicity did not influence the risk obviously. PMID: 25028192
  42. DR3 is expressed in some interstitial vascular endothelial cells (EC) in human kidney in situ; these EC also respond to its ligand TL1A by activating NF-kappaB. PMID: 25399326
  43. Mechanisms mediating TNFSF15:DR3 contributions to pattern recognition receptor outcomes included TACE-induced TNFSF15 cleavage to soluble TNFSF15; soluble TNFSF15 then led to TRADD/FADD/MALT-1- and caspase-8-mediated autocrine IL-1 secretion. PMID: 25197060
  44. This is the first report of the association between early Crohn's disease and the TNFSF15 single nucleotide polymorphisms. PMID: 25664710
  45. Tumor-infiltrating natural killer and CD4(+) T cells under the influence of cancer cells significantly increase the production of IFNgamma, which in turn inhibits TNFSF15 expression in vascular endothelial cells. PMID: 24141405
  46. may play an important role in the pathogenesis of primary biliary cirrhosis PMID: 24016146
  47. Our data demonstrate a key role for TL1A in promoting ILC2s at mucosal barriers. PMID: 24220298
  48. Combining the genetic marker TNFSF15 with ASCA IgA increased the power of predicting stenosis/perforating phenotype in Crohn's disease patients with TNFSF15 but not with a NOD2 genetic background PMID: 24783249
  49. genetic polymorphism is associated with psoriasis and psoriatic arthritis in Hungarians PMID: 24269700
  50. attenuated S. typhimurium carrying the dual function plasmid VEGI151/survivin cannot only be specifically enriched in the tumor tissue, but also showed a synergistic antitumor effect in vivo. PMID: 23404494

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 15, secreted form]: Secreted.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
Database Links

HGNC: 11931

OMIM: 604052

KEGG: hsa:9966

STRING: 9606.ENSP00000363157

UniGene: Hs.23349

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*