Recombinant Human Tumor necrosis factor ligand superfamily member 15(TNFSF15)

In Stock
Code CSB-AP004991HU
Product Type Tumor Necrosis Factor
Size US$153
Uniprot No. O95150
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.5
Alias Tumor Necrosis Factor Ligand Superfamily Member 15; TNF Ligand-Related Molecule 1; Vascular Endothelial Cell Growth Inhibitor; TNFSF15; TL1; VEGI
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using HUVEC cells is typically 5 ug/mL.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Research Area Cardiovascular
Source E.coli
Gene Names TNFSF15
Expression Region 1-192aa
Tag Info Tag-Free
Mol. Weight 21.86 kDa
Protein Description Full Length of Isoform?2
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
Subcellular Location Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 15, secreted form: Secreted
Protein Families Tumor necrosis factor family
Tissue Specificity Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
Database Links

HGNC: 11931

OMIM: 604052

KEGG: hsa:9966

STRING: 9606.ENSP00000363157

UniGene: Hs.23349

Related Products

TNFSF15 Antibodies

TNFSF15 Antibodies for Homo sapiens (Human)

TNFSF15 Antibodies for Human

TNFSF15 Proteins

TNFSF15 Proteins for Homo sapiens (Human)

TNFSF15 ELISA Kit

TNFSF15 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.