Recombinant Human Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A), partial (Active)

In Stock
Code CSB-MP873605HU
Abbreviation Recombinant Human TNFRSF12A protein, partial (Active)
MSDS
Size $108
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 (CSB-MP023987HU1) at 2 μg/ml can bind Human TNFRSF12A. The EC50 is 0.7706-0.9123 ng/mL. Biological Activity Assay
  • Activity
    Human TNFRSF12A captured on Protein A Chip can bind Recombinant Human TNFSF12 (CSB-MP023987HU1) with an affinity constant of 0.154 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF12 (CSB-MP023987HU1) at 2 μg/mL can bind Human TNFRSF12A. The EC50 is 0.7706-0.9123 ng/mL.
②Human TNFRSF12A captured on Protein A Chip can bind Recombinant Human TNFSF12 (CSB-MP023987HU1) with an affinity constant of 0.154 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor receptor superfamily member 12A; Fibroblast growth factor-inducible immediate-early response protein 14; FGF-inducible 14; Tweak-receptor; TweakR; CD antigen CD266
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
28-79aa
Target Protein Sequence
EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW
Mol. Weight
32.8 kDa
Protein Length
Partial
Tag Info
N-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
Gene References into Functions
  1. Expression level of Fn14 was significantly associated with overall survival and disease-free survival in low-grade gliomas. Fn14 was an independent predictive biomarker for the progression and prognosis in low-grade gliomas. PMID: 29741404
  2. TWEAK/Fn14 interaction induces proliferation and migration in human airway smooth muscle cells via activating the NF-kappaB pathway PMID: 29143982
  3. Data demonstrated that the Src/Fn14/NF-kappaB axis plays a critical role in NSCLC metastasis. PMID: 29500337
  4. Results show that Fn14 expression is high compared in non-small cell lung cancer compared to normal lung tissues. In addition, high Fn14 expression is associated with poor prognosis in lung adenocarcinoma. PMID: 29251323
  5. TWEAK/Fn14 contributes to endothelial dysfunction through modulation of reactive oxygen species (ROS), and mitochondrial ROS. PMID: 29257217
  6. Expression of the TWEAK-Fn14 axis was upregulated in patients with autoimmune thyroid disease and might play a role in the pathogenesis of autoimmune thyroid disease. PMID: 28636775
  7. Data suggest that expression of Fn14 on a tumor can initiate cachexia; an antibody against Fn14 may be an effective antineoplastic agent. [REVIEW] PMID: 27254081
  8. The results suggest that TWEAK/Fn14 interaction directly favors inorganic phosphate-induced vascular smooth muscle cells calcification by activation of both canonical and non-canonical NF-kappaB pathways. PMID: 27441657
  9. TWEAK upregulated the expression of Fn14. PMID: 28411440
  10. Fn14.TRAIL can be converted into a highly effective TRAIL oligomer upon binding to TWEAK which induces lymphoblast apoptosis. PMID: 28455246
  11. Data show that aurintricarboxylic acid (ATA) targets the TNF-related WEAK inducer of apoptosis (TWEAK)-fibroblast growth factor-inducible 14 (Fn14) signaling axis, which could potentially be developed as a new therapeutic agent for treatment of glioblastoma (GBM) patients. PMID: 28103571
  12. TNFRSF12A was knocked down in the SMMC7721 cell line through siRNA. This demonstrated that cells exhibited reduced reproductive and metastatic capacity ex vivo. PMID: 28138696
  13. In this review article, we summarize studies indicating that (i) Fn14 gene expression is low in normal brain tissue but is upregulated in advanced brain cancers and, in particular, in GB tumors ; TWEAK: Fn14 engagement as well as Fn14 overexpression can stimulate glioma cell migration, invasion and resistance to chemotherapeutic agents in vitro. PMID: 26300004
  14. Fn14 is a receptor of mitogen TWEAK (tumor necrosis factor-like weak inducer of apoptosis), expressed on the membranes of HPCs and promoting their proliferation. PMID: 28180936
  15. EGFR Del 19 may promote Fn14 and JAK1/STAT1 expression in NSCLC. PMID: 27350337
  16. TWEAK/Fn14 activation induces keratinocyte proliferation under psoriatic inflammation PMID: 26264384
  17. The results demonstrated that vitreous fluid from patients with PDR had higher levels of TWEAK and Fn14 than that from T2DM patients without PDR, thus suggesting an important regulatory role of TWEAK/Fn14 signaling in the pathogenesis of PDR. PMID: 27051016
  18. Results indicate that FN14 and GRP94 are prediction/prognosis markers which open up new possibilities for preventing/treating brain metastasis in breast cancer patients. PMID: 26497551
  19. Evidence that higher tumor Fn14 expression is required for pharmacodynamic response to the anti-TWEAK monoclonal antibody RG7212 in patients with Fn14-positive solid tumors. PMID: 26446946
  20. Fn14 has multiple roles in tumor metastasis. (Review) PMID: 26592249
  21. TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages. PMID: 26224570
  22. Activated Fn14 expression increases extracellular matrix synthesis and fibroblast activation. Activation of Fn14 is done by the TGF-beta signaling pathway through the transcription factor SMAD4. PMID: 26625141
  23. Fn14 modulates cell growth and drug resistance by upregulating Bcl-xl expression through the NF-kappaB pathway. PMID: 25054270
  24. Results indicate that oncogenic Src may contribute to Fn14 overexpression in solid tumors, and that Src mediated cell invasion could potentially be inhibited with Fn14- targeted therapeutics. PMID: 25392346
  25. HPV type 16 infections keratinocytes turns from apoptosis to proliferation cycle under FN14 protein influence. PMID: 26016896
  26. The first human data to show a transient activation of the TWEAK-Fn14 axis. PMID: 25539934
  27. TWEAK-Fn14 axis may be involved in the pathogenesis of polymyositis and dermatomyositis PMID: 24467773
  28. TweakR protein was expressed in about half of human breast cancer samples PMID: 25375638
  29. abundantly expressed in the dermal vessel wall of lesional skin in patients with urticarial vasculitis but not controls PMID: 23968277
  30. Results position TWEAK-Fn14 signaling through Mcl-1 as a significant mechanism for NSCLC tumor cell survival PMID: 24469836
  31. results define one upstream mechanism, via FN14 signaling, through which the NFkappaB pathway contributes to prostate cancer metastasis. PMID: 24970477
  32. Receptor-targeted therapeutics for both MET and FN14 are in clinical development, the use of which may mitigate the metastatic potential of NSCLC. PMID: 24710956
  33. insight into the Fn14 signaling mechanism PMID: 23750247
  34. High FN14 expression is associated with resistance to 5-fluorouracil in gastric cancer. PMID: 24337061
  35. a model in which constitutive down-regulation of Fn14 facilitates dynamic regulation of Fn14 protein levels and prevents spontaneous or inappropriate receptor signaling. PMID: 24652288
  36. We found that the TNF-like weak inducer of apoptosis (TWEAK)/fibroblast growth factor inducible-14 (Fn14) pathway is involved in the development of pathologic retinal neovascularization. PMID: 24408972
  37. These new findings of the effect of Fn14 on valvular interstitial cell-like differentiation may provide a novel therapeutic strategy for heart valve disease treatment. PMID: 24122208
  38. Increased podocyte Fn14 expression is associated with proteinuric kidney disease. PMID: 23999007
  39. Fn14 overexpression is associated with hepatocellular carcinoma. PMID: 23886137
  40. Induced overexpression of Fn14 levels in MCF7 cells through HER2 (ERBB2) signaling translated to an improved therapeutic index of hSGZ treatment. PMID: 23722548
  41. Fn14 protein may have a role in breast carcinoma progression PMID: 23300011
  42. results validate the TWEAK-Fn14 interaction as a chemically tractable target and provide the foundation for further exploration utilizing chemical biology approaches focusing on validating this system as a therapeutic target in invasive cancers. PMID: 24056367
  43. The Fn14/TWEAK pathway contributes to the endothelial steps of neuroinflammation. PMID: 23320797
  44. The expression of TWEAK and Fn14 in neuroblastoma suggests that TWEAK functions as an important regulator of primary neuroblastoma growth, invasion and survival. PMID: 23443741
  45. TWEAK/Fn14, by activating macrophages, could be ovarian tumor suppressors. PMID: 23469193
  46. we show that TWEAK/Fn14 can signal through the JAK-STAT pathway to induce interferon-beta, and that the ability of TWEAK to induce tumor cell apoptosis is mediated by JAK-STAT signaling. PMID: 23107828
  47. TWEAK binds to hFn14 by surface plasmon resonance (View interaction) xeFn14 binds to TWEAK by enzyme linked immunosorbent assay PMID: 23438059
  48. LCN2 and TWEAKR-TWEAK as crucial downstream effectors of NFAT1 that regulate breast cancer cell motility and invasive capacity. PMID: 22767506
  49. Fn14, the receptor for TNF-like weak inducer of apoptosis, is selectively upregulated in patients with Alcoholic Hepatitis. PMID: 22637703
  50. TWEAK/Fn14 can regulate expression and secretion of HMGB1 in monocytes/macrophages, participating in the inflammatory response associated with atherosclerotic plaque development. PMID: 23288170

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
Database Links

HGNC: 18152

OMIM: 605914

KEGG: hsa:51330

STRING: 9606.ENSP00000326737

UniGene: Hs.355899

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*