Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
ESCRT I complex subunit TSG101; ESCRT-I complex subunit TSG101; TS101_HUMAN; TSG 10; TSG 101; TSG10; Tsg101; Tumor susceptibility 101; Tumor susceptibility gene 10; Tumor susceptibility gene 101; Tumor susceptibility gene 101 protein; Tumor susceptibility protein; Tumor susceptibility protein isoform 3; VPS 23; VPS23
Species
Homo sapiens (Human)
Expression Region
1-145aa
Target Protein Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our high-quality Recombinant Human TSG101 protein is a valuable resource for researchers investigating tumor susceptibility. This partial Tumor susceptibility gene 101 protein is expressed in the E.coli system, covering the 1-145aa region. For efficient protein purification and detection, our TSG101 protein is designed with an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, ensuring consistent performance and reproducible results throughout your experiments.
Our Recombinant Human TSG101 protein boasts a purity greater than 85% as determined by SDS-PAGE and is available in both liquid and lyophilized powder forms. Trust in this exceptional protein to support your research endeavors and deliver reliable, high-quality results.