Recombinant Human Tumor susceptibility gene 101 protein(TSG101),partial

In Stock
Code CSB-EP860355HU1
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q99816
Lead Time 3-7 business days
Relevance Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Research Area Others
Source E.coli
Gene Names TSG101
Protein Names ESCRT-I complex subunit TSG101
Expression Region 1-145aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 36.6 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan
Subcellular Location Cytoplasm, Early endosome membrane, Peripheral membrane protein, Cytoplasmic side, Late endosome membrane, Peripheral membrane protein, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Midbody, Midbody ring, Nucleus
Protein Families Ubiquitin-conjugating enzyme family, UEV subfamily
Tissue Specificity Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
Database Links

HGNC: 15971

OMIM: 601387

KEGG: hsa:7251

STRING: 9606.ENSP00000251968

UniGene: Hs.523512

Pathway Endocytosis
Secreted Extracellular Vesicles

Related Products

TSG101 Antibodies

TSG101 Antibodies for Homo sapiens (Human)

TSG101 Proteins

TSG101 Proteins for Homo sapiens (Human)

TSG101 ELISA Kit

TSG101 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.