Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial

In Stock Promotion
Code CSB-EP860355HU1a0
Abbreviation Recombinant Human TSG101 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(ESCRT-I complex subunit TSG101)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-145aa
Target Protein Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.7 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan. It may also play a role in the extracellular release of microvesicles that differ from the exosomes.
Gene References into Functions
  1. this is the first study that implicates the importance of TSG101 in anoikis resistance of thyroid cancer. PMID: 30343281
  2. In LNCaP prostate cancer cells, TSG101 overexpression recruits the androgen receptor (AR) to TSG101-containing cytoplasmic vesicles resulting in reduced AR protein level and AR transactivation activity downregulation. Immunofluorescence microscopy demonstrated that TSG101-decorated cytoplasmic vesicles are associated with late endosomes/lysosomes. PMID: 29859188
  3. The authors provide evidence that the ubiquitin (Ub) E2 variant domain of Tsg101 provides chaperone function to HIV-1 Gag that is independent of its interaction with the Pro-Thr-Ala-Pro motif, supporting the hypothesis that the domain provides a function in addition to its well-established role in cellular endosomal sorting complex required for transport factor recruitment. PMID: 29123089
  4. In this review, HIV-infected cells have TSG101 on their surface and thus can be used in antibody-based therapies. The development of a monoclonal antibody CB8-2 lessens the assembly of viruses from infected cells PMID: 29199609
  5. Results indicate that Vpr overcomes the effects of TSG101 overexpression to support viral production by competing with TSG101 to bind Gag. PMID: 27648839
  6. our studies reveal that Tsg101 plays a role in the trafficking of macropinocytosed Kaposi's sarcoma-associated herpesvirus in the endothelial cells PMID: 27764233
  7. Knockdown of LAMP2A, a CMA-related protein, and TSG101, an mA-related protein, significantly but only partially decreased the punctate accumulation of GAPDH-HT in AD293 cells and primary cultured rat cortical neurons. PMID: 27377049
  8. the variant alleles of TSG101 rs2292179 and ATF2 rs3845744 were associated with a reduced risk of breast cancer, particularly for subjects with BMI <24 (kg/m(2)) and postmenopausal women, respectively PMID: 26729199
  9. TSGDelta154-1054 splice variant increases TSG101 oncogenicity by inhibiting its E3-ligase-mediated proteasomal degradation. PMID: 26811492
  10. Results show that TSG101 bidirectionally modulates cell invasion through regulating MMP-9 mRNA expression in different cell types. PMID: 26608825
  11. TSG101 plays an important role in the development of hepatocellular carcinoma PMID: 26537625
  12. Expression of tsg101 mRNA and of TSG101 protein were significantly higher in the oxaliplatin resistant cell line than parent HT-29 cels. PMID: 26400331
  13. PSAP motif of OFR3 is required for hepatitis E virus exit and interaction with host TSG101. PMID: 26457367
  14. Stress-internalized EGFR is retained intracellularly by continued p38 activity in a mechanism involving ubiquitin-independent, ESCRT/ALIX-dependent incorporation onto intraluminal vesicles (ILVs) of MVBs PMID: 26066081
  15. Tsg101 is necessary for the efficient transport and release of nucleocapsids in marburg virus-infected cells PMID: 25330247
  16. our findings strongly suggest that TSG101 is a cellular target for HSV-1 tegument ubiquitin specific protease activity during infection. PMID: 25510868
  17. Our findings thus indicate that TSG101 regulation of p21 is an important factor in the cellular function of TSG101. PMID: 24244542
  18. The ESCRT component TSG101 is required for optimal Human papillomavirus 16 infection. PMID: 25010273
  19. These data support the interferon-induced generation of a Tsg101- and ISG15-dependent checkpoint in the secretory pathway that compromises influenza virus release. PMID: 24237697
  20. Authors describe a novel compound (compound 0013) that blocks the JUNV Z-Tsg101 interaction and inhibits budding of virus-like particles. PMID: 24522922
  21. Knock down of TSG101 causes the EGFR to accumulate in low density endosomes. PMID: 23933150
  22. Data indicate tht n the Biaka, strong signal of selection was detected at CUL5 and at TSG101. PMID: 23217182
  23. These results support a model in which both HIV-1 Gag-induced membrane curvature and Gag-ESCRT interactions promote tetherin recruitment, but the recruitment level achieved by the former is sufficient for full restriction. PMID: 23408603
  24. The results provide evidence for a two-step splicing pathway of the TSG101 mRNA in which the initial constitutive splicing removes all 14 authentic splice sites, thereby bringing the weak alternative splice sites into close proximity. PMID: 22675076
  25. The expression of TSG101 in HCC is higher than that in corresponding non-cancer tissues and the expression level is closely correlated with TNM stage and metastasis of HCC. PMID: 22768867
  26. identified TSG101 as a novel FIP4-binding protein, which can also bind FIP3. alpha-helical coiled-coil regions of both TSG101 and FIP4 mediate the interaction with the cognate protein PMID: 22348143
  27. Overexpression of PEG10 and TSG101 was detected in gallbladder adenocarcinoma. PMID: 21455631
  28. Depletion of endogenous Tsg101 by siRNA led to a significant reduction of HEV release in cultured cells. PMID: 21880841
  29. HIV-1 infection affects the expression of host factors TSG101 and Alix PMID: 21528537
  30. TSG101 knockdown in breast cancer cells induces apoptosis and inhibits proliferation. TSG101 may play a biological role through modulation of the MAPK/ERK signaling pathway in breast cancer. PMID: 21117030
  31. TSG101 may induce the malignant phenotype of cells. PMID: 19787439
  32. Taken together, these data indicate that Marburg virus nucleoprotein enhances budding of virus-like particles by recruiting Tsg101 to the VP40-positive budding site through a PSAP late-domain motif. PMID: 20504928
  33. Results suggest that TSG101 down-regulation in cervical cancer cells is not regulated by genetic or epigenetic events. PMID: 20372822
  34. show that ubiquitin recognition by TSG101 is required for cSMAC formation, T cell receptor (TCR) microcluster signal termination, TCR downregulation. PMID: 20399684
  35. recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates. PMID: 11916981
  36. Negative regulation of cell growth and differentiation by TSG101 through association with p21(Cip1/WAF1). PMID: 11943869
  37. structure and functional interactions of its binding sites PMID: 12006492
  38. solution structure of the UEV (ubiquitin E2 variant) binding domain of Tsg101 in complex with a PTAP peptide that spans the late domain of HIV-1 p6(Gag) PMID: 12379843
  39. interacts specifically with human immunodeficiency virus type 2 gag polyprotein, results in increased levels of ubiquinated gag, and is incorporated into HIV-2 virions PMID: 12388682
  40. Human ortholog TSG101 does not substitute VPS23 in its ability to rescue the phenotype of defective plasma membrane proteins PMID: 12725919
  41. truncated and full length forms of TSG101 inhibit HIV-1 budding by interacting with the p6 L domain and by disrupting the cellular endosomal sorting machinery PMID: 12743307
  42. the TSG101 interaction with HRS is a crucial step in endocytic down-regulation of mitogenic signaling and this interaction may have a role in linking the functions of early and late endosomes PMID: 12802020
  43. alternative splicing and role implicated in interaction with HIV-1 PMID: 14526201
  44. TSG101 activates androgen receptor-induced transcription by transient stabilization of the monoubiquitinated state PMID: 14761944
  45. Reduction of TSG101 protein has a negative impact on breast and prostate tumor cell growth PMID: 14991575
  46. molecular interactions between Daxx and TSG101 establish an efficient repressive transcription complex in the nucleus PMID: 15033475
  47. X-ray crystallography study of the UEV domain of TSG101 and ubquitin showed the basis for the binding recognition at high resolution. PMID: 15053872
  48. Tsg101 and Nedd4.1 act successively in the assembly process of HTLV-1 to ensure proper Gag trafficking through the endocytic pathway up to late endosomes where the late steps of retroviral release occur. PMID: 15126635
  49. TSG101 binds GR and protects the non-phosphorylated receptor from degradation. PMID: 15657031
  50. interaction of Gag with Tsg101 and Alix favors budding from the plasma membrane and relieves a requirement for ubiquitination by Nedd4 PMID: 15908698

Show More

Hide All

Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Late endosome membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody, Midbody ring. Nucleus.
Protein Families
Ubiquitin-conjugating enzyme family, UEV subfamily
Tissue Specificity
Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
Database Links

HGNC: 15971

OMIM: 601387

KEGG: hsa:7251

STRING: 9606.ENSP00000251968

UniGene: Hs.523512

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*