Recombinant Human Vascular endothelial growth factor B (VEGFB), partial

In Stock
Code CSB-EP025834HU1
Size $390
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
VEGFB
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
31-129aa
Target Protein Sequence
HQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
11.3 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
Gene References into Functions
  1. High plasma VEGF-B levels are associated with type 2 diabetes mellitus. PMID: 28523459
  2. Data from clinical studies point out the changes in circulating or tissue expression levels of VEGF-B in obese compared with lean patients. PMID: 28798193
  3. Cardiac transgenic vascular endothelial growth factor-B overexpression failed to protect heart transplants from ischemia-reperfusion injury. PMID: 27588416
  4. renal VEGF-B expression correlates with the severity of Diabetic Kidney Disease. PMID: 28190774
  5. Data show that metformin treatment reduces serum vascular endothelial growth factor B (VEGF-B) levels and ameliorates insulin resistance. PMID: 26387747
  6. Frameshift mutations of VEGFB gene is associated with stomach and colorectal cancers. PMID: 25633991
  7. fluid shear stress induces the synthesis of Insulin growth factor-2 and vascular endothelial growth factor (VEGF) B and D, which in turn transactivate MMP-12. PMID: 25435370
  8. MMP9 may activate VEGF-B via PI3K/Akt signaling pathway. PMID: 25424698
  9. Roles of vascular endothelial growth factor in amyotrophic lateral sclerosis. PMID: 24987705
  10. Low VEGFB and VEGFD gene expression is associated with early-stage non-small cell lung cancer. PMID: 24145997
  11. Our study suggested that VEGF-B was an angiogenesis factor in vitro and that ERK1/2 and p38-related signaling pathways were involved in these VEGF-B activities. PMID: 24374930
  12. VEGF-B has possible roles in cardiac protection, energy metabolism support, and neuroprotectin [review] PMID: 24987005
  13. High VEGF-B levels might correlate with the presence of hyperlipidemia and target organ damage in type 2 diabetic patients. PMID: 25001655
  14. High VEGFB expression is associated with bone marrow metastasis in neuroblastoma. PMID: 23553333
  15. VEGF-B might be an important ligand in the signalling between the tumor and preexisting blood vessels to ensure a functional blood supply for tumor survival. PMID: 23417498
  16. we report significant associations with overall survival and distant failure for certain VEGF(VEGF-B) family members. PMID: 23728940
  17. Data indicate that three miRs (miR-484, -642, and -217) were able to predict chemoresistance and vasculature of serous epithelial ovarian carcinomas through the regulation of the VEGFB and VEGFR2 pathways. PMID: 23697367
  18. Expression of VEGF-B genes in glioma cell lines U87 is significantly changed under hypoxia and ischemic conditions. PMID: 23350126
  19. In WT1 mutant cells, reduced VEGF(165)b was due to lack of WT1-mediated transcriptional repression of the splicing-factor kinase SRPK1 PMID: 22172722
  20. analysis of binding of vascular endothelial growth factor-B by VEGFR-1(D2) PMID: 20501651
  21. TIMP3 blocks the binding of VEGF to VEGF receptor-2 and inhibits downstream signaling and angiogenesis. PMID: 12652295
  22. Results describe the crystal structure of human vascular endothelial growth factor-B (VEGF-B) and present a predicted model for the association of VEGF-B with the second domain of its receptor, VEGFR-1. PMID: 16616187
  23. Basophils could play a role in angiogenesis and inflammation through the expression of several forms of VEGF-B and their receptors. PMID: 17082651
  24. VEGFB, and receptor were highly expressed in dysplastic neurons. IR in astroglial and balloon cells was observed for VEGFA and its receptors Double-labeling also showed expression of VEGFA, VEGFB and VEGFR-1 in cells of the microglia/macrophage lineage. PMID: 18317782
  25. VEGF-B appears to have a relatively restricted angiogenic activity in the ischemic heart. PMID: 18511699
  26. Increased VEGFB expression is associated with hepatocellular carcinoma PMID: 18537151
  27. Overexpression of vascular endothelial growth factor-B in mouse heart alters cardiac lipid metabolism and induces myocardial hypertrophy. PMID: 18757827
  28. The structural features of the 'highly ordered' interaction of the Fab fragment of the antibody (Fab-2H10) with VEGF-B, is presented. PMID: 18930733
  29. VEGF-B mRNA was not expressed either in normal urothelium or in bladder cancer. PMID: 19424629

Show More

Hide All

Subcellular Location
Secreted. Note=Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
Database Links

HGNC: 12681

OMIM: 601398

KEGG: hsa:7423

STRING: 9606.ENSP00000311127

UniGene: Hs.732095

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*