Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P15130

Research Area

Microbiology

Alternative Names

Nucleocapsid protein

Species

Human coronavirus 229E (HCoV-229E)

Source

E.coli

Expression Region

1-389aa

Target Protein Sequence

MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.4 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The DNA fragment encoding the 1-389aa of the humancoronavirus 229E Nucleoprotein (N) protein was fused with N-terminal 6xHis tag gene and then was inserted into the expression vector, which was subsequently transformed into the E.coli for expression. The resulting product was further purified to obtain the recombinant human coronavirus 229E Nucleoprotein (N) protein. The purity of this recombinant Nucleoprotein (N) protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This Nucleoprotein (N) protein showed a band on the gel with a molecular weight of approximately 55 kDa.

Studies indicated that N protein could interact with SARS and COVID-19. Among them, a study pointed that in patients with COVID-19, N antibodies have been observed, suggesting that N protein is capable of producing an immune response. To some extent, researchers revealed that N protein is very likely to preform additional roles during the viral infection. Besides, N proteins are served as inhibitors of interferon (IFN) in pathogenicity because N proteins were documented to antagonize the IFN response. Some researchers also discovered that N proteins of SARS-CoV-2 plays an important role in the inhibition of IFN-βproduction.

Target Background

Function

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Gene References into Functions

N protein mutants with truncated C-terminal domains were generated and investigated by biophysical and biochemical analyses to clarify the role of the C-terminal tail of the N protein in oligomerization PMID: 23178926
Nucleocapsid protein expression facilitates coronavirus replication PMID: 17037502

Subcellular Location

Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.

Protein Families

Alphacoronavirus nucleocapsid protein family

Database Links

KEGG: vg:918763

Code	CSB-EP322753HIT
Abbreviation	Recombinant Human coronavirus 229E N protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human coronavirus 229E Nucleoprotein (N)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage