Recombinant Human coronavirus 229E Nucleoprotein (N)

In Stock
Code CSB-BP322753HIT
Abbreviation Recombinant Human coronavirus 229E N protein
MSDS
Size $317
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein
Species
Human coronavirus 229E (HCoV-229E)
Source
Baculovirus
Expression Region
1-389aa
Target Protein Sequence
MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus 229E Nucleoprotein (N) is produced using a baculovirus expression system, which appears to ensure high-quality protein production. The full-length protein spans 1-389 amino acids and comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag for easier purification and detection. SDS-PAGE analysis shows the purity exceeds 85%, making this recombinant protein suitable for various research applications that demand high-quality reagents.

Human coronavirus 229E's Nucleoprotein (N) plays a critical role in the viral replication cycle. It participates in packaging viral RNA and forming the ribonucleoprotein complex—both essential for efficient viral transcription and replication. Studying this protein may be crucial for understanding coronavirus biology mechanisms and could potentially lead to therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This full-length recombinant HCoV-229E nucleoprotein can work as an immunogen for generating monoclonal or polyclonal antibodies specific to coronavirus 229E. The dual His and Myc tags help with purification and detection during antibody screening. Researchers might use this protein in ELISA-based assays to characterize antibody binding specificity, affinity, and cross-reactivity with other coronavirus nucleoproteins. The high purity (>85%) likely ensures reliable and reproducible results in immunization protocols and subsequent antibody validation experiments.

2. Protein-Protein Interaction Studies

Both the N-terminal His tag and C-terminal Myc tag make this nucleoprotein suitable for pull-down assays designed to identify cellular proteins that interact with HCoV-229E nucleoprotein during infection. Researchers can immobilize the protein on nickel-affinity resins or use anti-Myc antibodies for immunoprecipitation experiments with cell lysates. These studies may help clarify the molecular mechanisms by which coronavirus nucleoproteins interact with host cell machinery. The baculovirus expression system probably provides proper protein folding, which seems important for maintaining native protein-protein interaction capabilities.

3. Structural and Biochemical Characterization

This recombinant nucleoprotein works well in biophysical studies investigating the structural properties and stability of HCoV-229E nucleoprotein. The full-length construct (1-389aa) lets researchers study the complete protein structure using techniques like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation. The dual tagging system makes protein detection and quantification easier during purification and analysis procedures. Such studies could provide insights into nucleoprotein folding, oligomerization states, and thermal stability under various buffer conditions.

4. Comparative Coronavirus Research

This HCoV-229E nucleoprotein can serve as a reference standard in comparative studies examining nucleoprotein sequences, structures, and properties across different coronavirus species. Researchers might use this protein alongside nucleoproteins from other coronaviruses to study evolutionary relationships and identify conserved functional domains. The standardized expression system and purification tags create consistent experimental conditions when comparing multiple coronavirus nucleoproteins. Comparative analyses like these may contribute to understanding common mechanisms of coronavirus replication and pathogenesis.

5. Assay Development and Optimization

The dual-tagged nucleoprotein provides a valuable tool for developing and optimizing various biochemical assays related to coronavirus research. The His tag creates consistent purification protocols, while the Myc tag allows for standardized detection methods using commercially available anti-Myc antibodies. Researchers can use this protein to establish standard curves, validate assay sensitivity and specificity, and optimize experimental conditions for nucleoprotein-based studies. The defined purity level (>85%) offers a reliable standard for quantitative assay development and quality control procedures.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Gene References into Functions
  1. N protein mutants with truncated C-terminal domains were generated and investigated by biophysical and biochemical analyses to clarify the role of the C-terminal tail of the N protein in oligomerization PMID: 23178926
  2. Nucleocapsid protein expression facilitates coronavirus replication PMID: 17037502
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Alphacoronavirus nucleocapsid protein family
Database Links

KEGG: vg:918763

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*