Recombinant Human coronavirus 229E Nucleoprotein (N)

In Stock
Code CSB-BP322753HIT
Abbreviation Recombinant Human coronavirus 229E N protein
MSDS
Size $317
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N
Uniprot No.
Research Area
Microbiology
Alternative Names
Nucleocapsid protein
Species
Human coronavirus 229E (HCoV-229E)
Source
Baculovirus
Expression Region
1-389aa
Target Protein Sequence
MATVKWADASEPQRGRQGRIPYSLYSPLLVDSEQPWKVIPRNLVPINKKDKNKLIGYWNVQKRFRTRKGKRVDLSPKLHFYYLGTGPHKDAKFRERVEGVVWVAVDGAKTEPTGYGVRRKNSEPEIPHFNQKLPNGVTVVEEPDSRAPSRSQSRSQSRGRGESKPQSRNPSSDRNHNSQDDIMKAVAAALKSLGFDKPQEKDKKSAKTGTPKPSRNQSPASSQTSAKSLARSQSSETKEQKHEMQKPRWKRQPNDDVTSNVTQCFGPRDLDHNFGSAGVVANGVKAKGYPQFAELVPSTAAMLFDSHIVSKESGNTVVLTFTTRVTVPKDHPHLGKFLEELNAFTREMQQHPLLNPSALEFNPSQTSPATAEPVRDEVSIETDIIDEVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human coronavirus 229E Nucleoprotein (N) is produced using a baculovirus expression system, which appears to ensure high-quality protein production. The full-length protein spans 1-389 amino acids and comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag for easier purification and detection. SDS-PAGE analysis shows the purity exceeds 85%, making this recombinant protein suitable for various research applications that demand high-quality reagents.

Human coronavirus 229E's Nucleoprotein (N) plays a critical role in the viral replication cycle. It participates in packaging viral RNA and forming the ribonucleoprotein complex—both essential for efficient viral transcription and replication. Studying this protein may be crucial for understanding coronavirus biology mechanisms and could potentially lead to therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The protein is expressed in a baculovirus system (eukaryotic, supporting native-like folding and post-translational modifications [PTMs]—critical for the full-length HCoV-229E nucleoprotein [N] to interact with viral RNA and host factors). Full-length expression (1–389 aa) preserves all functional domains, and dual tags (10xHis-N-terminal, Myc-C-terminal) minimally disrupt structure. However, no direct validation of folding (e.g., circular dichroism for secondary structure, thermal shift assays for stability) or native bioactivity (e.g., RNA binding affinity, oligomerization, or host protein interactions) is provided. While baculovirus expression strongly suggests correct folding, bioactivity remains unconfirmed, limiting definitive claims about its native functionality.

1. Antibody Development and Validation Studies

This full-length recombinant HCoV-229E N protein can serve as an immunogen for generating monoclonal/polyclonal antibodies, and the dual tags simplify purification/detection. However, antibody specificity must be validated against native N—baculovirus expression preserves conformational epitopes, but tag presentation may alter antigenicity, leading to cross-reactivity with non-native targets. ELISA can screen for affinity, but validation with native protein or infected cells is critical.

2. Protein-Protein Interaction Studies

Pull-down assays using the His/Myc tags can identify host interactors, but results depend on correct folding—baculovirus expression improves native folding, but interactions must be validated via co-IP or functional assays to rule out artifacts from misfolding. The full length preserves all potential domains, but bioactivity (e.g., RNA binding) is unconfirmed.

3. Structural and Biochemical Characterization

This protein supports biochemical assays (e.g., thermal stability, oligomerization) and structural studies (e.g., circular dichroism, analytical ultracentrifugation). Baculovirus expression ensures native-like structure, but the C-terminal Myc tag may interfere with high-resolution techniques (e.g., crystallography)—tag cleavage (via protease) may improve results. RNA binding and nucleocapsid assembly must be validated experimentally.

4. Comparative Coronavirus Research

This baculovirus-expressed N protein enables cross-reactivity studies with other coronavirus N proteins, as standardized folding reduces variability. However, PTMs may differ slightly between species—results should be contextualized, and direct comparisons (e.g., antibody cross-reactivity) must account for evolutionary divergence.

5. Assay Development and Optimization

The dual-tagged N protein is a useful immunoassay standard, but its native conformation must be confirmed—the tags enable consistent detection, but assay performance (sensitivity/specificity) may differ if the protein misfolds. Validate with native N or clinical samples to ensure relevance to HCoV-229E biology.

Final Recommendation & Action Plan

This baculovirus-expressed, full-length HCoV-229E N protein is a strong candidate for antibody development, immunoassays, and comparative research due to its eukaryotic folding. Prioritize validation of folding (CD/thermal shift) and bioactivity (RNA binding/oligomerization) to ensure reliability. For interactions or structural studies, use tag cleavage if needed and pair with co-IP/functional assays. If validation passes, leverage its consistency for downstream applications—always include native N controls to contextualize results. If folding/bioactivity fails, optimize expression (e.g., co-express chaperones) or use a viral replication system to produce native protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
Gene References into Functions
  1. N protein mutants with truncated C-terminal domains were generated and investigated by biophysical and biochemical analyses to clarify the role of the C-terminal tail of the N protein in oligomerization PMID: 23178926
  2. Nucleocapsid protein expression facilitates coronavirus replication PMID: 17037502
Subcellular Location
Virion. Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus.
Protein Families
Alphacoronavirus nucleocapsid protein family
Database Links

KEGG: vg:918763

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*