Recombinant Listeria monocytogenes serotype 4b Internalin-A(inlA) ,partial

Code CSB-EP758331LAAD
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q723K6
Abbreviation inlA
Relevance Mediates the entry of Listeria monocytogenes into cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Listeria monocytogenes serotype 4b (strain F2365)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT
Research Area Others
Source E.coli
Gene Names inlA
Protein Names Recommended name: Internalin-A
Expression Region 562-770aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 38.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the entry of Listeria monocytogenes into cells.
Subcellular Location Secreted, cell wall, Peptidoglycan-anchor
Database Links

KEGG: lmf:LMOf2365_0471

Q&A and Customer Reviews

Q&A
Q:

For CSB-XP758331LAAD, I ask if this protein has been tested in ELISA assay.

A:
Very nice to receive your inquiry. CSB-XP758331LAAD
Expression Region: 562-770aa;
What we provide is the concentrated region of C-terminal antigenic epitopes that is highly immunologically active.
Antibodies produced by immunization can be used as a very important marker for detection of Listeria monocytogenes infestation.
Pls refer to: http://www.sciencedirect.com/science/article/pii/S0167701205003738
Sorry, we haven't tested this protein in ELISA.
Customer Reviews

Related Products

inlA Antibodies

inlA Antibodies for Listeria monocytogenes serotype 4b

inlA Antibodies for Listeria monocytogenes serotype 4b (strain F2365)

inlA Proteins

inlA Proteins for Listeria monocytogenes serotype 4b (strain F2365)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.