Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

In Stock
Code CSB-MP018988MOV4
Abbreviation Recombinant Cynomolgus monkey PTH1R protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 1.072 to 1.403 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 1.072 to 1.403 ng/mL.
Target Names
Uniprot No.
Alternative Names
Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; Parathyroid hormone 1 receptor; PTH1R
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
29-188aa
Target Protein Sequence
DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPANIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
Mol. Weight
20.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

PTH1R mediates the actions of parathyroid hormone and PTHrP in calcium homeostasis and bone remodeling, making its extracellular domain a critical target for therapeutic antibody development and ligand-binding studies. This cynomolgus monkey ortholog, spanning residues 29–188 of the N-terminal extracellular region, demonstrates quantifiable binding to an anti-PTH1R recombinant antibody with an EC50 of 1.072–1.403 ng/mL in functional ELISA, providing a validated basis for competitive inhibition assays, blocking antibody screening, and epitope mapping experiments. Mammalian cell expression preserves the native glycosylation and disulfide architecture essential for conformationally dependent antibody recognition, supporting its use in affinity characterization by surface plasmon resonance or biolayer interferometry. The protein meets purity thresholds exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, satisfying the quality criteria typical for ligand-receptor interaction studies and therapeutic antibody validation workflows in drug discovery programs targeting PTH1R signaling.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*