Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 1.072 to 1.403 ng/mL.

Target Names

PTH1R

Uniprot No.

A0A2K5V724

Alternative Names

Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; Parathyroid hormone 1 receptor; PTH1R

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

29-188aa

Target Protein Sequence

DDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPANIMESDKGWTSTSTSGKPRKDKPSGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG

Mol. Weight

20.0 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

PTH1R mediates the actions of parathyroid hormone and PTHrP in calcium homeostasis and bone remodeling, making its extracellular domain a critical target for therapeutic antibody development and ligand-binding studies. This cynomolgus monkey ortholog, spanning residues 29–188 of the N-terminal extracellular region, demonstrates quantifiable binding to an anti-PTH1R recombinant antibody with an EC50 of 1.072–1.403 ng/mL in functional ELISA, providing a validated basis for competitive inhibition assays, blocking antibody screening, and epitope mapping experiments. Mammalian cell expression preserves the native glycosylation and disulfide architecture essential for conformationally dependent antibody recognition, supporting its use in affinity characterization by surface plasmon resonance or biolayer interferometry. The protein meets purity thresholds exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, satisfying the quality criteria typical for ligand-receptor interaction studies and therapeutic antibody validation workflows in drug discovery programs targeting PTH1R signaling.

Code	CSB-MP018988MOV4
Abbreviation	Recombinant Cynomolgus monkey PTH1R protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularit PTH1R at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC₅₀ is 1.072 to 1.403 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Macaca fascicularis Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

×CloseMessage