Recombinant Macaca fascicularis cytokine receptor-like factor 2 (CRLF2), partial (Active)

In Stock
Code CSB-MP5357MOVd7
Abbreviation Recombinant Cynomolgus monkey CRLF2 protein, partial (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis CRLF2 at 2 μg/ml can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 2.079-2.450 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis CRLF2 at 2 μg/mL can bind Anti-CRLF2 recombinant antibody(CSB-RA005983MA1HU). The EC50 is 2.079-2.450 ng/mL.
Target Names
Uniprot No.
Alternative Names
/
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
23-231aa
Target Protein Sequence
QVATGEGLQIQIMYFNLETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAQQQDDILYFSIRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDTEWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGKTRDSCPEPRTPPKPKLSK
Mol. Weight
25.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CRLF2 forms a heterodimeric receptor complex with IL-7Rα and mediates TSLP signaling, a pathway implicated in allergic inflammation and certain B-cell acute lymphoblastic leukemias. This recombinant protein, spanning the extracellular domain (aa 23–231) and produced in mammalian cells to preserve native glycosylation and disulfide bonding, demonstrates quantifiable antibody-binding activity with an EC50 of 2.079–2.450 ng/mL in functional ELISA, confirming conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation. The low endotoxin level (less than 1.0 EU/μg) and greater than 95% purity meet the quality thresholds commonly required for ligand-binding assays, surface plasmon resonance affinity characterization, and biolayer interferometry studies. Researchers investigating TSLP-driven immune responses or developing biologics targeting the CRLF2–IL-7Rα axis can use this protein as a positive control in binding assays or as an immobilized ligand for screening small-molecule or biologic inhibitors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*