Recombinant Macaca mulatta (Rhesus macaque) Interleukin-10(IL10),Baculovirus

In Stock
Code CSB-BP011580MOW
Product Type Recombinant Protein
Size US$2240Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P51496
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Research Area Others
Source Baculovirus
Gene Names IL10
Protein Names Recommended name: Interleukin-10 Short name= IL-10 Alternative name(s): Cytokine synthesis inhibitory factor Short name= CSIF
Expression Region 19-178aa
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: mcc:694931

STRING: 9544.ENSMMUP00000031022

UniGene: Mmu.3374

Pathway Jak-STAT signaling pathway
T cell receptor signaling pathway
FoxO signaling pathway

Q&A and Customer Reviews

Q&A
Q:

Please can you provide information on which tagged form of the product we will receive and provide a predicted MWt for the protein including any tag. Also please confirm which tagged form is shown in the SDS-PAGE image.cccccx

A:
Thanks for your inquiry. Tag information is N-terminal 10xHis-tagged and C-terminal myc-tagged.
Predicted MW (protein and tag) is 22.7 KD.
N-terminal 10xHis-tagged and C-terminal myc-tagged is shown in the SDS-PAGE.
Customer Reviews

Related Products

IL10 Antibodies

IL10 Antibodies for Macaca mulatta (Rhesus macaque)

IL10 Proteins

IL10 Proteins for Macaca mulatta (Rhesus macaque)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.