Recombinant Macaca mulatta Interleukin-10(IL10)

In Stock
Code CSB-MP011580MOW
Lead Time 3-7 business days
Product Type Recombinant Protein
Size Pls inquiry other sizesPurchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P51496
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Research Area Immunology
Source Mammalian cell
Gene Names IL10
Protein Names Cytokine synthesis inhibitory factor
Expression Region 19-178aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info C-terminal 10xHis-tagged
Mol. Weight 20.7kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular location Secreted
Pathway Jak-STAT signaling pathway
T cell receptor signaling pathway
FoxO signaling pathway

Related Products

IL10 Antibodies

IL10 Antibodies for Homo sapiens (Human)

IL10 Antibodies for Bos taurus (Bovine)

IL10 Antibodies for Macaca mulatta (Rhesus macaque)

IL10 Proteins

IL10 Proteins for Mus musculus (Mouse)

IL10 Proteins for Homo sapiens (Human)

IL10 Proteins for Bos taurus (Bovine)

IL10 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

IL10 Proteins for Macaca mulatta (Rhesus macaque)

IL10 Proteins for Felis catus (Cat) (Felis silvestris catus)

IL10 Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

IL10 Proteins for Rattus norvegicus (Rat)

IL10 Proteins for Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)

IL10 Proteins for Cervus elaphus (Red deer)

IL10 Proteins for Macaca nemestrina (Pig-tailed macaque)

IL10 Proteins for Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)

IL10 Proteins for Pan troglodytes (Chimpanzee)

IL10 Proteins for Trichosurus vulpecula (Brush-tailed possum)

IL10 Proteins for Orcinus orca (Killer whale)

IL10 Proteins for Callithrix jacchus (White-tufted-ear marmoset)

IL10 Proteins for Equus caballus (Horse)

IL10 Proteins for Vulpes vulpes (Red fox)

IL10 Proteins for Sus scrofa (Pig)

IL10 Proteins for Ovis aries (Sheep)

IL10 Proteins for Bubalus carabanensis (Swamp type water buffalo) (Bubalus bubalis carabanensis)

IL10 Proteins for Gallus gallus (Chicken)

IL10 Proteins for Papio hamadryas (Hamadryas baboon)

IL10 Proteins for Lama glama (Llama)

IL10 Proteins for Saimiri sciureus (Common squirrel monkey)

IL10 Proteins for Oryctolagus cuniculus (Rabbit)

IL10 Proteins for Marmota monax (Woodchuck)

IL10 cDNA

IL10 cDNA for Rattus norvegicus (Rat)

IL10 cDNA for Ovis aries (Sheep)

IL10 cDNA for Equus caballus (Horse)

IL10 cDNA for Sus scrofa (Pig)

IL10 cDNA for Bos taurus (Bovine)

IL10 cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

IL10 cDNA for Macaca mulatta (Rhesus macaque)

IL10 cDNA for Felis catus (Cat) (Felis silvestris catus)

IL10 cDNA for Gallus gallus (Chicken)

IL10 cDNA for Homo sapiens (Human)

IL10 ELISA Kit

IL10 ELISA Kit for Bos taurus (Bovine)

IL10 ELISA Kit for Felis catus (Cat) (Felis silvestris catus)

IL10 ELISA Kit for Gallus gallus (Chicken)

IL10 ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

IL10 ELISA Kit for Cavia porcellus (Guinea pig)

IL10 ELISA Kit for Equus caballus (Horse)

IL10 ELISA Kit for Homo sapiens (Human)

IL10 ELISA Kit for Mus musculus (Mouse)

IL10 ELISA Kit for Sus scrofa (Pig)

IL10 ELISA Kit for Oryctolagus cuniculus (Rabbit)

IL10 ELISA Kit for Rattus norvegicus (Rat)

IL10 ELISA Kit for Ovis aries (Sheep)

Most popular with customers

+ Show More

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.