Recombinant Macaca mulatta Interleukin-10(IL10)

In Stock
Code CSB-MP011580MOW
Product Type Recombinant Protein
Size US$1232Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P51496
Lead Time 3-7 business days
Relevance Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Research Area Immunology
Source Mammalian cell
Gene Names IL10
Protein Names Cytokine synthesis inhibitory factor
Expression Region 19-178aa
Tag Info C-terminal 10xHis-tagged
Mol. Weight 20.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Subcellular Location Secreted
Protein Families IL-10 family
Database Links

KEGG: mcc:694931

STRING: 9544.ENSMMUP00000031022

UniGene: Mmu.3374

Pathway Jak-STAT signaling pathway
T cell receptor signaling pathway
FoxO signaling pathway

Related Products

IL10 Antibodies

IL10 Antibodies for Macaca mulatta (Rhesus macaque)

IL10 Proteins

IL10 Proteins for Macaca mulatta (Rhesus macaque)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.