Recombinant Mouse Aldehyde dehydrogenase 1A1 (Aldh1a1)(171-178:FPMLMFIW→Missing)

In Stock
Code CSB-EP001565MO(M)
Abbreviation Recombinant Mouse Aldh1a1 protein (Mutant type)
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
3-deoxyglucosone dehydrogenase;ALDH-E1;ALHDII;Aldehyde dehydrogenase family 1 member A1;Aldehyde dehydrogenase, cytosolic;Retinal dehydrogenase 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2-501aa(171-178:FPMLMFIW→Missing)
Target Protein Sequence
SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.151.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytosolic dehydrogenase that catalyzes the irreversible oxidation of a wide range of aldehydes to their corresponding carboxylic acid. Functions downstream of retinol dehydrogenases and catalyzes the oxidation of retinaldehyde into retinoic acid, the second step in the oxidation of retinol/vitamin A into retinoic acid. This pathway is crucial to control the levels of retinol and retinoic acid, two important molecules which excess can be teratogenic and cytotoxic (Probable). Also oxidizes aldehydes resulting from lipid peroxidation like (E)-4-hydroxynon-2-enal/HNE, malonaldehyde and hexanal that form protein adducts and are highly cytotoxic. By participating for instance to the clearance of (E)-4-hydroxynon-2-enal/HNE in the lens epithelium prevents the formation of HNE-protein adducts and lens opacification. Functions also downstream of fructosamine-3-kinase in the fructosamine degradation pathway by catalyzing the oxidation of 3-deoxyglucosone, the carbohydrate product of fructosamine 3-phosphate decomposition, which is itself a potent glycating agent that may react with lysine and arginine side-chains of proteins. Has also an aminobutyraldehyde dehydrogenase activity and is probably part of an alternative pathway for the biosynthesis of GABA/4-aminobutanoate in midbrain, thereby playing a role in GABAergic synaptic transmission.
Gene References into Functions
  1. Data indicate involvement of non-POU domain-containing octamer-binding protein (NONO)/paraspeckle protein component 1 (PSPC1)-aldehyde dehydrogenase 1 (NONO/PSPC1-ALDH1A1) in the modulation of Sertoli cells (SCs) response to mono-(2-ethylhexyl) phthalate (MEHP) challenge. PMID: 28117896
  2. In ovaries lacking ALDH1A1, the onset of germ cell meiosis is delayed. PMID: 26892828
  3. Dioxin receptor regulates aldehyde dehydrogenase to block melanoma tumorigenesis and metastasis PMID: 26242870
  4. these experiments reveal an evolutionarily conserved GABA synthesis pathway mediated by aldehyde dehydrogenase 1a1 (ALDH1a1). PMID: 26430123
  5. Respiratory tract epithelial cells express retinaldehyde dehydrogenase ALDH1A and enhance IgA production by stimulated B cells in the presence of vitamin A. PMID: 24466150
  6. Dkk-1 enhances resistance of osteosarcoma cells to stress by tipping balance of Wnt signaling in favor of the non-canonical Jun-mediated Wnt pathways. In turn, this results in transcriptional activation of ALDH1 through Jun-responsive promoter elements. PMID: 24577091
  7. Deletion of Aldh1a1 exacerbated alpha-synuclein-mediated DA neurodegeneration and alpha-synuclein aggregation, whereas Aldh1a1-null and control DA neurons were comparably susceptible to 1-methyl-4-phenylpyridinium-, glutamate-, or camptothecin-induced cell death. PMID: 24865427
  8. Our findings indicated that increased expression of ALDH1A1 in nasopharyngeal carcinoma was associated with enhanced invasiveness in the nude mouse. PMID: 23625387
  9. PSMB8, ALDH1A1, and HSPA4 were identified to be located in ovarian tissues, to regulate 12 cellular pathways, and demonstrate age-dependent dynamic changes in expression profiling. PMID: 24156634
  10. beta-escin inhibits tobacco carcinogen-induced lung tumor formation by modulating ALDH1A1-positive cells and RhoA/Rock signaling PMID: 23963803
  11. ALDH1A1 deficiency induces BMP2 and increases bone mass in vivo. PMID: 23951127
  12. retinoic acid-producing enzyme aldehyde dehydrogenase 1a1 (Aldh1a1) is an oncogene suppressor in specific B cell populations. PMID: 24080087
  13. Expression of ALDH1A1 isozyme transcripts was highest in ALDH(very-br) cells, intermediate in ALDH(br) cells, and lowest in ALDH(dim) cells. PMID: 23484127
  14. high fat diet mediates visceral fat formation through a sex-specific autocrine Aldh1 switch. PMID: 22933113
  15. Retinaldehyde dehydrogenase 1 coordinates hepatic gluconeogenesis and lipid metabolism PMID: 22555438
  16. analysis of neurodegeneration and motor dysfunction in mice lacking cytosolic and mitochondrial aldehyde dehydrogenases PMID: 22384032
  17. This result demonstrates the critical role of stress resistance in myogenic cell therapy as well as confirms the role of ALDH as a marker for rapid isolation of murine and human myogenic progenitors for cell therapy. PMID: 22195027
  18. data establish Aldh1a1 and its substrate Rald as previously unrecognized determinants of adipocyte plasticity and adaptive thermogenesis, which may have potential therapeutic implications PMID: 22561685
  19. ALDH1A1 deficiency increases ALDH3A1 expression. Mice deficient in both ALDH3A1 & ALDH1A1 have fewer HSCs, aberrant cell-cycle distribution, increased reactive oxygen species, p38 MAP kinase activity & sensitivity to DNA damage. PMID: 22198153
  20. expression can be detected in canals of Hering and bile duct epithelial cells and is increased on liver injury PMID: 21953779
  21. in young adult animals with deletion of the Aldh1a1 gene there is altered dopamine metabolism and dysfunction of the dopamine transporter and dopamine release mechanisms PMID: 21784415
  22. regulation of fat depots through the concerted action of Aldh1 enzymes establishes retinoic acid-dependent tandem regulation of transcription factors ZFP423 and PPARgamma in a depot-specific manner PMID: 21436255
  23. Aldh1a1 plays a major role in cellular defense against oxidative damage induced by reactive lipid aldehydes in mouse liver PMID: 21256123
  24. We observed a decrease in the average number of Aldh1a1-positive cells in tumours with a non-invasive vs. solid morphology and in the average number of Aldh1a1-positive mammary tumour cells in low vs. intermediate and low vs. high-nuclear grade tumours. PMID: 21059124
  25. Retinoic acid-dependent signaling within the intestine is indispensable for RALDH enzyme activity in the draining mesenteric lymph nodes. PMID: 21220692
  26. The addition of all trans retinoic acid blocked DEAB-mediated expansion of ST-HSCs in culture, suggesting that ALDH1a1 regulates HSC differentiation via augmentation of retinoid signaling. PMID: 20054864
  27. Three retinaldehyde dehydrogenases (RALDH1, RALDH2 and RALDH3), show differential expression patterns throughout later mouse organogenesis PMID: 11744377
  28. RA-generating activities in Raldh2-null mouse embryos could be ascribed to RALDH1 in eye, nasal, and inner ear epithelia. PMID: 12454286
  29. RA signaling may be necessary only during early stages of retina development and is catalyzed by multiple enzymes, including Raldh1 PMID: 12808103
  30. Raldh1 functions downstream of Adh1 in the oxidative metabolism of excess retinol PMID: 12851412
  31. Expression of aldehyde dehydrogenase 1A1 (ALDH1A1) mRNA was found to be higher in brains of DBA/2 mice. PMID: 17010133
  32. ALDH1A1 mRNA. 3-deoxyglucosone dehydrogenase activity was undetectable in tissues from ALDH1A1(-/-) mice. PMID: 17175089
  33. Cellular expression of Aldh1 in the GI tract was studied. PMID: 17257171
  34. corneal ALDH3A1 and lens ALDH1A1 protect the eye against cataract formation via nonenzymatic (light filtering) and enzymatic (detoxification) functions. PMID: 17567582
  35. Aldh1a1 is not a critical regulator of adult stem cell function PMID: 18971422
  36. the Aldh1a1 gene is strongly expressed in a male-specific manner in somatic cells of the developing testis, beginning shortly after Sry expression is first detectable PMID: 19618468

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Cell projection, axon.
Protein Families
Aldehyde dehydrogenase family
Tissue Specificity
Expressed in retina. Expressed in lens and cornea (at protein level). Expressed by midbrain dopamine neurons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*