Recombinant Mouse Angiopoietin-related protein 4 (Angptl4)

Code CSB-MP4186MO
Abbreviation Recombinant Mouse Angptl4 protein
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal transduction
Alternative Names
425O18-1;Angiopoietin-like protein 4;Fasting-induced adipose factor;Hepatic fibrinogen/angiopoietin-related protein;Secreted protein Bk89
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-410aa
Target Protein Sequence
QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
111.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal HSA-tagged and C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. May also play a role in regulating glucose homeostasis and insulin sensitivity. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro). Depending on context, may modulate tumor-related angiogenesis (Probable).; Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism. Has higher activity in LPL inactivation than the uncleaved protein.
Gene References into Functions
  1. miR-134 accelerates atherogenesis by promoting lipid accumulation and proinflammatory cytokine secretion via the ANGPTL4/LPL pathway PMID: 28867683
  2. Functional studies in Angptl4-deficient mice confirm improved insulin sensitivity and glucose homeostasis. PMID: 29899519
  3. Data show that angiopoietin-like protein 4 (ANGPTL4)deficiency in mice knockout (ANGPTL4(-/-)) exacerbated colonic inflammation induced by dextran sulfate sodium (DSS) or stearic acid. PMID: 28287161
  4. Angptl4 is induced early in fasting to divert uptake of fatty acids and triglycerides away from adipose tissues. PMID: 28752045
  5. haematopoietic ANGPTL4 deficiency increases atherogenesis through regulating myeloid progenitor cell expansion and differentiation, foam cell formation and vascular inflammation. PMID: 27460411
  6. Following ANGPTL4 downregulation, the proliferation and invasion abilities of gastric cancer (GC)cell lines were suppressed as determined by MTT and Transwell assays, and cell apoptosis level and sensitivity to cisplatin were increased as determined by flow cytometry and MTT assay. In conclusion, these findings suggest that ANGPTL4 may be a new potential therapeutic target for GC PMID: 29436683
  7. The influence of H2O2 on ANGPTL4 provided new insight into the mechanism of atherosclerosis. PMID: 28849063
  8. The reduction of plasma triglyceride levels in Angptl4(-/-) mice and increase following Angptl4 overexpression suggest that changes in plasma triglyceride metabolism do not regulate alpha-cells in the pancreas. Our findings corroborate recent data showing that increased plasma amino acids and their transport into alpha-cells link glucagon receptor blockage to alpha-cell hyperplasia PMID: 28143927
  9. study demonstrates the key role of Angptl4 in glucocorticoid-augmented hepatic ceramide production that induces whole-body insulin resistance. PMID: 28743803
  10. 1) ANGPTL4 is not involved in the triglyceride-lowering effect ofbile acids ; 2) ANGPTL4 promotes bile acids absorption during taurocholic acid supplementation via a mechanism dependent on the gut microbiota. PMID: 28733267
  11. physiological changes in adipose tissue ANGPTL4 expression during fasting and cold resulted in inverse changes in the amount of mature-glycosylated LPL in wild-type mice, but not Angptl4(-/-) mice. We conclude that ANGPTL4 promotes loss of intracellular LPL by stimulating LPL degradation after LPL processing in the endoplasmic reticulum (ER). PMID: 27034464
  12. Angptl4-deficient mice show impaired insulin secretion and dysmorphic pancreatic islets. PMID: 28188788
  13. Angptl4 induces obesity-associated metabolic disorders. The present study suggested that Angptl4 promotes liver steatosis and lipolysis, in addition to impairing liver function; while Angptl4 improves glucose tolerance and insulin resistance, in addition to causing the downregulation of various insulin signaling pathway-associated genes. PMID: 27573470
  14. ANGPTL4 is part of a shuttling mechanism that directs fatty acids derived from circulating triglyceride-rich lipoproteins to brown adipose tissue during cold. PMID: 26476336
  15. these results suggest that IL-1beta increases Angptl4 expression through a mechanism dependent on the JNK-MAPK signaling pathway in MC3T3-E1 cells. PMID: 26069075
  16. glucagon receptor antagonist improves glycemia in diet-induced obese angptl4 knockout mice without increasing glucagon levels or alpha-cell proliferation, underscoring the importance of this protein. PMID: 26621734
  17. This study showed that phloridzin improved plasma lipoprotein lipase activity via a decrease of ANGPTL4 mRNA expression and an increase of AMP-activated protein kinase phosphorylation. PMID: 24932810
  18. Letter: Angiopoietin-like 4 is induced during sebocyte differentiation and regulates sebaceous lipogenesis in vitro but is dispensable for sebaceous gland function in vivo. PMID: 24815769
  19. GR and FoxO1 are required for Angptl4 transcription activation, and that FoxO1 negatively mediates the suppressive effect of insulin PMID: 24565756
  20. ANGPTL4 is a genetically and epigenetically inactivated secreted tumor suppressor that inhibits tumor angiogenesis. PMID: 23686315
  21. inactivation of LPL by Angptl4 appears to occur after both proteins have traveled along the secretory pathway and arrived at the cell surface. PMID: 24220340
  22. Angptl4 is necessary for rapid modulation of lipoprotein lipase activity in adipose tissue. PMID: 23176178
  23. Depletion of adipose angiopoietin-like 4 abolishes intermittent hypoxia-induced dyslipidemia and atherosclerosis in mice, and is regulated by hypoxia-inducible factor-1. PMID: 23328524
  24. Angptl4 suppresses foam cell formation to reduce atherosclerosis development. PMID: 23640487
  25. Angptls would be useful in instances where there is a need to maintain HSCs ex vivo, such as during transduction for gene therapy applications PMID: 22639947
  26. Locally expressed Angptl4 might play a role in local uterine/placental lipid metabolism. PMID: 22350948
  27. The effect of Toll-like Receptor activation on the expression of macrophage ANGPTL4 was studied. PMID: 22538368
  28. Angptl4 mRNA expression was increased through the elevated free FAs in diabetic mice. PMID: 22068616
  29. Data showed that PPARbeta/delta regulates epidermal maturation via ANGPTL4-mediated signalling pathway. PMID: 21966511
  30. ANGPTL4 tunes endothelial cell junction organization and pericyte coverage and controls vascular permeability and angiogenesis, both during development and in pathological conditions. PMID: 21832056
  31. serum LDL, HDL and TG levels are decreased in LDLR-, Angptl- mice. PMID: 21549101
  32. the cleavage of ANGPTL4 by these PCs modulates its inhibitory effect on LPL activity. PMID: 21398697
  33. Angiopoietin-like 4 interacts with integrins beta1 and beta5 to modulate keratinocyte migration. PMID: 20952587
  34. Angptl4 protects against severe proinflammatory effects of saturated fat by inhibiting fatty acid uptake into mesenteric lymph node macrophages. PMID: 21109191
  35. Decreased fat storage by Lactobacillus paracasei is associated with increased levels of ANGPTL4. PMID: 20927337
  36. Valsartan reduced fiaf gene expression in subcutaneous, but not visceral, fat in the ob/ob mouse. PMID: 20472602
  37. Angptl4-null mice were resistant to diet-induced obesity, indicating obesity-promoting effects of Angptl4 under the condition of fat-enriched diet. PMID: 20798332
  38. ANGPTL4 interacts with vitronectin and fibronectin in the wound bed, delaying their proteolytic degradation by metalloproteinases. PMID: 20729546
  39. Stimulation of cardiac Angptl4 gene expression by dietary fatty acids and via PPARbeta/delta is part of a feedback mechanism aimed at protecting the heart against lipid overload and consequently fatty acid-induced oxidative stress. PMID: 20378851
  40. These studies demonstrate that ANGPTL4 is a positive acute phase protein and the increase in ANGPTL4 could contribute to the hypertriglyceridemia that characteristically occurs during the acute phase response by inhibiting LPL activity. PMID: 20043872
  41. potent hyperlipidemia-inducing factor in mice and inhibitor of lipoprotein lipase PMID: 12401877
  42. FIAF may partially exert its function via a truncated form PMID: 15190076
  43. angiopoietin-like protein 4 has an oligomerization state-dependent hyperlipidemic effect PMID: 15292369
  44. Induction of Angptl4 in the heart inhibits lipoprotein-derived fatty acid delivery. PMID: 15659544
  45. Differential regulation of Angptl3 & Angptl4 by sites of expression, nutritional status, & ligands of nuclear receptors may confer unique roles of each in lipoprotein metabolism. Angptl4 expression is activated by ligands of all PPAR. PMID: 15863837
  46. Angptl4 is a potential angiogenic mediator in arthritis. PMID: 15870027
  47. Angptl4-deficient mice had hypotriglyceridemia and increased postheparin plasma lipoprotein lipase, with greater effects in fasted state. Deficiecy in both Angptl proteins had additive effect on plasma triglycerides with survival not past 2 months of age. PMID: 16081640
  48. via physical association with plasma lipoproteins, FIAF acts as a powerful signal from fat and other tissues to prevent fat storage and stimulate fat mobilization PMID: 16272564
  49. First report of molecular cloning and characterization of ANGPT4in pigs, which will be helpful for a better understanding of the role of ANGPTLs in lipid metabolism. PMID: 16717449
  50. Hypoxia/ischaemia rapidly increased fiaf mRNA in the injured cortex and hippocampus at 2 and 7 days after hypoxia/ischaemia. PMID: 16837853

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space, extracellular matrix.
Tissue Specificity
Detected in liver and kidney. Predominantly expressed in adipose tissue and is strongly up-regulated by fasting in white adipose tissue and liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*