Recombinant Mouse Bone morphogenetic protein 4 (Bmp4)

Code CSB-EP002740MO
Abbreviation Recombinant Mouse Bmp4 protein
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Bone morphogenetic protein 2B
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
293-408aa
Target Protein Sequence
SPKHHPQRSRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including neurogenesis, vascular development, angiogenesis and osteogenesis. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR2. Once all three components are bound together in a complex at the cell surface, BMPR2 phosphorylates and activates BMPR1A. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical BMP pathways such as ERK/MAP kinase, PI3K/Akt or SRC cascades. For example, induces SRC phosphorylation which, in turn, activates VEGFR2, leading to an angiogenic response.
Gene References into Functions
  1. The importance of the BMP4 pathway in endogenous tissue regeneration and offer a potential clinical approach to enhance T cell immunity. PMID: 29330161
  2. BMP4 and IL7 appear to be involved in the interaction between intestinal epithelial cells and intestinal epithelial cells and in the mechanism underlying intestinal mucosal barrier dysfunction. PMID: 29436597
  3. Knockdown of BMP4 in pregnant mice at the middle embryonic stage led to aganglionosis. PMID: 29393463
  4. we demonstrated that the anterior and posterior phenotypes observed in Bmp4 heterozygous animals showed a strong propensity to co-occur, suggesting a common, non-cell autonomous source for these defects. PMID: 29738572
  5. MiR-876-5p suppresses epithelial-mesenchymal transition of lung cancer by directly down-regulating BMP-4. PMID: 29229885
  6. p73 is required for appropriate BMP-induced mesenchymal-to-epithelial transition during somatic cell reprogramming. PMID: 28880267
  7. BMP4 inhibits type 2 epithelial cells (AT2s) proliferation, whereas antagonists (follistatin, noggin) promote AT2 self-renewal at the expense of differentiation. Gain- and loss-of-function genetic manipulation reveals that reduced BMP signaling in AT2s after PNX allows self-renewal but reduces differentiation PMID: 29752282
  8. this study shows that negative autoregulation of BMP4 dependent transcription by SIN3B splicing reveals a role for RBM39 PMID: 27324164
  9. Gene expression profiling showed that MuSK was required for the BMP4-induced expression of a subset of genes in myoblasts, including regulator of G protein signaling 4 (Rgs4). PMID: 27601729
  10. differentiated cells exhibited contracting masses. These results suggest that BMP4-mediated somatic stem cell reprogramming may become an alternative approach for cell therapy PMID: 28170287
  11. Bmp4 promotes a brown to white-like adipocyte shift. PMID: 27524617
  12. results suggest that bone morphogenetic protein 4 promotes the generation of male germ cells from induced pluripotent stem (iPS) cells PMID: 27864336
  13. These results suggest how BMP4 regulates adipocyte recruitment in subcutaneous (SC) white adipose tissue, and thus promote its beneficial metabolic effects. PMID: 27030507
  14. RUNX1T1 serves as a common angiogenic driver for vaculogenesis and functionality of endothelial lineage cells PMID: 28640846
  15. Expression of Bmp4 in the ureteric mesenchyme depends on HH signaling and Foxf1, and that exogenous BMP4 rescued cell proliferation and epithelial differentiation in ureters with abrogated HH signaling or FOXF1 function. PMID: 28797033
  16. These data indicate that Foxc1 expression is regulated by BMP4 and FOXC1 functions in the commitment of progenitor cells to the osteoblast fate and its expression is reduced when differentiation proceeds. PMID: 26666591
  17. Phosphorylated Smad1/5/8/9 specifically bound to the BREs of Smad8/9 gene. The present study reveals that Smad8/9 is a unique R-Smad regulated through the BMP pathway at the mRNA level. PMID: 26748560
  18. Treatment of ES cells with TPO induced the autocrine production of BMP4 with concomitant upregulation of the BMP receptor BMPR1A, phosphorylation of SMAD1, 5, 8, and activation of specific BMP4 target genes; this was mediated by TPO-dependent binding of transcription factor HIF-1alpha to the BMP4 gene promoter. PMID: 27447537
  19. Data suggest that ovarian Bmp4 levels are significantly decreased in a mouse model of polycystic ovary syndrome with hyperandrogenism; androgens inhibited Bmp4 expression via activation of androgen receptors; Smad4 signaling rather than p38 MAPK pathway regulates androgen and estrogen formation. PMID: 28572510
  20. tightly spatial interaction of FSTL1 and BMP4 signaling plays an essential role in lung development PMID: 27355685
  21. this study identified Bmp4 as a significant factor for improved maintenance of Foxn1 expression, promotion of thymic epithelial progenitor populations self-renewal and immature epithelial cell differentiation and survival PMID: 27861793
  22. these data reveal a novel mechanism that the Bmp4-Msx1 pathway and Osr2 control tooth organogenesis through antagonistic regulation of expression of secreted Wnt antagonists. PMID: 27713059
  23. inhibitory role on glucagon secretion, pancreatic alpha-cell growth, and expression of genes maintaining alpha-cell identity PMID: 27479530
  24. We demonstrate that elevated BMP4 depletes PSM progenitors in vitro, phenocopying the Fgf3 mutant, suggesting that excessive BMP signals cause the Fgf3 axis defect. To test this in vivo we increased BMP signaling in Fgf3 mutants by removing one copy of Noggin, which encodes a BMP antagonist. PMID: 27144312
  25. BMP-4 inhibited insulin signaling through activation of PKC-theta; isoform, and resulted in insulin resistance through the attenuation of insulin signaling PMID: 28186649
  26. BMP4 inhibited ERalpha signaling by increasing the degradation of ERalpha, and that the expression of BMP4 itself was suppressed by estrogens. PMID: 27522322
  27. the present study suggested that miRNA378 is critical for the promotion of myoblast differentiation by targeting BMP4. PMID: 26782975
  28. Increased BMP signaling contributes significantly to impairments in neurogenesis and to cognitive decline associated with aging PMID: 26827654
  29. findings suggest that Sox6 contributes to cell survival by suppressing BMP-4 transcription during neuronal differentiation PMID: 26590087
  30. Data show that R-Smad Proteins SMAD1 and SMAD5, which transduce bone morphogenetic protein (BMP) signals, recognize enhancer regions together with Kruppel-like factors KLF4 and KLF5 in naive embryonic stem cell (mESCs). PMID: 26771354
  31. Ino80 represses Bmp4 expression during embryonic stem cell differentiation. PMID: 26975355
  32. PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. PMID: 26769046
  33. BMP4 has a role in inducing NOX1-dependent eNOS uncoupling in T2DM, which may promote development of novel therapeutics restoring endothelial function in T2DM PMID: 26121233
  34. resveratrol markedly amplifies BMP4induced OPG mRNA expression. PMID: 26044505
  35. BMP4 promotes activation of FGF7 and FGF10 signaling, leading to an increase in proliferative basal cell population in developing skin. PMID: 25329657
  36. calbindin1 in rat primary islet cells reduced glucose-stimulated insulin secretion (GSIS), and the effect of BMP4 on GSIS was lost in islets from calbindin1 (Calb1) knockout mice PMID: 25828920
  37. Wnt/beta-catenin signaling modulates corneal epithelium stratification via inhibition of Bmp4 during mouse development. PMID: 26443636
  38. Bmp4, Bmp7 and bmpr2 signalling regulates the pre-implantation development of extra-embryonic cell lineages in the mouse embryo PMID: 25514175
  39. Transfection of Pax9 and Bmp4 into mouse induced pluripotent stem cells facilitates their differentiation into odontoblast-like cells for cell- and tissue-based therapy. PMID: 26136503
  40. the BMP4 prodomain is necessary and sufficient to generate stable BMP4/7 heterodimers PMID: 25902523
  41. Bmp4 from the optic vesicle has a role in murine retina formation PMID: 25792196
  42. BMP4-induced upregulation of Cav3.1 mRNA. PMID: 24510064
  43. Megf8 is involved in mediating BMP4 signaling and guidance of developing trigeminal ganglia axons. PMID: 24052814
  44. A transient wave of BMP signaling in the retina is necessary for Muller glial differentiation. PMID: 25605781
  45. BMP4 plays an important anti-inflammatory role, controlling the strength and facilitating the resolution of acute lung inflammation; yet, BMP4 also contributes to lung function impairment during chronic lung inflammation. PMID: 25142202
  46. BMP4 reduces the expression and secretion of G-CSF by inhibiting NF-kappaB (Nfkb1) activity in human and mouse tumor lines. PMID: 25224959
  47. BMP4 induced lipid-laden foam cell formation by inhibiting cholesterol efflux via ABCA1 and ABCG1 through the BMPR-2/Smad1/2/8 signaling pathway. PMID: 24690996
  48. Bone morphogenetic protein-1/mTLD and PCPE-1 are upregulated in corneal scars. Both proteins may therefore contribute to the process of corneal scarring. PMID: 25249603
  49. the transient BMP4 prodomain/ligand complex that forms during sequential cleavage plays an essential role in prodomain-mediated stabilization of the mature ligand PMID: 24993941
  50. BMP4 signaling reduces inflammation and inhibits dysplastic changes in the gastric mucosa after infection of mice with H pylori or H felis. PMID: 24751878

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
TGF-beta family
Tissue Specificity
In the cochlea, detected in nonprosensory regions and outer sulcus (at protein level). Prior to gastrulation, expressed in the extraembryonic ectoderm. Later, expressed in the extraembryonic mesoderm.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*