Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active)

In Stock
Code CSB-MP6512MO
Abbreviation Recombinant Mouse Ccl17 protein (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/ml can bind Mouse Ccl17 protein. The EC50 is 0.9792-1.486 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Mouse Ccl17 protein. The EC50 is 0.9792-1.486 ng/mL.
Target Names
Uniprot No.
Alternative Names
C-C motif chemokine 17; ABCD-2; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; Ccl17; Tarc
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-93aa
Target Protein Sequence
ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Mol. Weight
37.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CCL17 orchestrates T helper 2 cell recruitment to sites of allergic inflammation and tumor microenvironments, making quantitative assessment of its chemotactic potency essential for modeling Th2-driven pathology. This mammalian-expressed construct spanning residues 24–93 demonstrates robust receptor engagement in functional ELISA, binding immobilized anti-CCL17 antibody with an EC50 of 0.98–1.49 ng/mL—a quantitative benchmark that supports dose-response studies in chemotaxis assays, T cell migration experiments, and CCR4 signaling pathway investigations including MAPK and calcium flux activation. Endotoxin levels below 1.0 EU/μg meet the contamination thresholds required for primary immune cell assays, where LPS artifacts would confound interpretation of CCL17-specific effects on Th2 differentiation or regulatory T cell function. The C-terminal mFc tag facilitates immunoprecipitation and surface plasmon resonance studies while the >95% purity provides a clean reagent for antibody development workflows, including use as coating antigen in sandwich immunoassays or as a positive control in Western blot validation of anti-CCL17 detection reagents.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*