Recombinant Mouse C-C motif chemokine 3 (Ccl3)

In Stock
Code CSB-EP004793MO
Abbreviation Recombinant Mouse Ccl3 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ccl3; Mip1a; Scya3C-C motif chemokine 3; Heparin-binding chemotaxis protein; L2G25B; Macrophage inflammatory protein 1-alpha; MIP-1-alpha; SIS-alpha; Small-inducible cytokine A3; TY-5
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
24-92aa
Target Protein Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.
Gene References into Functions
  1. During early remission from methamphetamine (MA), model mice exhibited increased anxiety-like behavior and reduced expression of chemokine (C-C motif) ligand 3 (ccl3) in the hippocampus relative to saline-treated mice. Human adults actively dependent on MA and those in early remission had elevated symptoms of anxiety as well as reductions in plasma levels of CCL3, relative to adults with no history of MA abuse. PMID: 29402784
  2. miR-125b could play an important role in inflammatory injury of chondrogenic cells and miR-125b affected inflammatory injury of ATDC5 cells via regulating expression of MIP-1alpha and regulating NF-kappaB and JNK signaling pathways. PMID: 29550827
  3. Leukemogenic effects of the Ptpn11E76K/+mutation in the stem-cell microenvironment is abolished in Ptpn11E76K/+Prx1-Cre+CCL3-/- mice, indicating that CCL3 is important for leukemic transformation. PMID: 28751523
  4. Parenchymal polymorphonuclear myeloid-derived suppressor cell (PMN-MDSC), have a positive correlation with IL1a, IL8, CXCL5, and Mip-1a, suggesting they may attract PMN-MDSC into the tumor PMID: 27799249
  5. CCL3 plays a significant role in the clearance of infection and resolution of otitis media inflammation and contributes to mucosal host defense of the nasopharyngeal niche, a reservoir for middle ear and upper respiratory infections. PMID: 28847849
  6. Cytokine array analysis demonstrated that the chemokine CCL3 was elevated in the plasma of AML mice and patients. CCL3 inhibited erythroid differentiation of hematopoietic stem cells, common myeloid progenitors and especially megakaryocytic-erythroid progenitors. PMID: 27109512
  7. MCP chemokines are activated in peripheral tissues of breast cancer-bearing mice, by a mechanism that involves breast cancer cell-derived Ccl3. PMID: 28041977
  8. These observations suggest that intra-BM basophil expansion can favor leukemia-tropic hematopoiesis in myeloid leukemia by providing CCL3, a potent inhibitor of normal hematopoiesis and that basophil-derived CCL3 may be a novel target molecule for the treatment of myeloid leukemia. PMID: 27006388
  9. A marked increase of CCL3 mRNA expression was observed in inflamed paws, with CCL3 protein detected in neutrophils and macrophages by immunohistochemical experiments. PMID: 26663750
  10. CCL2/CCL3 double-mutant animals are viable, fertile, and do not present with gross abnormalities. Cuprizone increased CCL3 expression in wild-type but not mutant mice. Cuprizone-induced demyelination, oligodendrocyte loss, and astrogliosis were significantly ameliorated in the cortex but not corpus callosum of chemokine-deficient animals. PMID: 25663168
  11. these data suggest that the chemokine CCL3 is an hippocampal neuromodulator able to regulate synaptic plasticity mechanisms involved in learning and memory functions. PMID: 26511387
  12. Ccl3 mRNAs increased within 5 h after injury in mouse cortical slices. PMID: 25895671
  13. Previous exposure to noninjurious ventilation induces a state of tolerance to ventilator-induced lung injury. Down regulation of the chemokine gene Ccl3 could be the mechanism responsible for this effect. PMID: 26472813
  14. the tissue fibrinolytic system contributes to the induction of macrophage recruitment and CCL3 at the bone injury site, thereby, leading to the enhancement of the repair process. PMID: 25893677
  15. APOE varepsilon4 genotype specifically modulates astrocyte secretion of potent microglial chemotactic agents, including CCL3 PMID: 25092803
  16. In experimental autoimmune encephalomyelitis there was a significant increase in activation of astrocytes with increased MIP-1alpha expression. PMID: 24989845
  17. Negative modulation of PGE2 signaling reduced infection-induced anti-inflammatory cytokine polarization and enhanced inflammatory chemokines, CCL3 and CCL5. PMID: 25049356
  18. Granzyme M regulates the release of natural killer cell MIP-1alpha to initiate innate immune responses. PMID: 24625974
  19. CCL3-CCR5-mediated fibroblast accumulation may be required, in addition to leukocyte infiltration, to induce full-blown colitis-associated carcinogenesis. PMID: 24510316
  20. CCL3 production by microglial cells modulates disease severity in murine models of retinal degeneration. PMID: 24639355
  21. results define the chemokine CCL3 as a mediator of experimental liver fibrosis. Thus, therapeutic modulation of CCL3 might be a promising target for chronic liver diseases PMID: 23799074
  22. BCR-ABL(+)lineage(-)c-kit(-) immature leukemia cells produced high levels of an inflammatory chemokine, MIP-1alpha/CCL3, which promoted the development of chronic myeloid leukemia. PMID: 24166712
  23. The CCR5/MIP-1alpha axis may contribute to migration of infected cells to the brain and consequently affect the pathogenesis during Rocio virus infection. PMID: 24080631
  24. Data indicate that Bifidobacterium infantis feeding to Salmonella-infected mice significantly reduced Peyer's patch MIP-1alpha and MIP-1beta secretion. PMID: 23648818
  25. IFN-gamma and NOS2 repress CCL3 and CCL4 in vivo upon S. typhimurium infection of mice also repress CCL3 and CCL4 during S. typhimurium infection in bone marrow-derived macrophages. PMID: 23431040
  26. Under conditions of acute inflammation leukocyte-derived CCL3 can induce neutrophil chemotaxis toward the atherosclerotic plaque, thereby accelerating lesion formation. PMID: 23288165
  27. findings show that CCR1 is pivotal for bone remodeling induced by mechanical loading during orthodontic tooth movement and these actions depend, at least in part, on CCL3 PMID: 23059626
  28. Hyperocclusion induced compensatory CCL3 expression; promoted osteoclastogenesis to counterbalance deficient CCL2/CCR2 signaling. co-expression of CCL3 with CCL2 may precipitate synergistic, MS-dependent alveolar destruction during occlusal traumatism. PMID: 23143790
  29. The kinetics and extent of microglia and astrocyte activation during early and late cuprizone-induced demyelination in the white matter tract corpus callosum and the telencephalic gray matter were related to the expression of the Ccl2 and Ccl3. PMID: 22528463
  30. Expression of ALDH1A2, BEX2, EGR2, CCL3 and PLAU are upregulated in Toxoplasma gondii susceptible C57BL/6 mice. PMID: 22451728
  31. role for CCL3 in lipid metabolism in hyperlipidemic mice following hematopoietic reconstitution. PMID: 22359597
  32. In a murine carotid aneurysm model of vascular inflammatory repair, monocyte chemotactic protein (MCP)-1-mediated tissue in-growth occurs via a MIP-1alpha- and MIP-2-regulated pathway. PMID: 22007074
  33. our data indicate that the interaction between TTP and CCL3 mRNA plays an important role in modulating localized inflammatory processes in tissues that are dissociated from the systemic manifestations of chronic inflammation. PMID: 21784977
  34. The selective interaction of CCL3 with its receptor, CCR1, is critical for radiation-induced lung inflammation and fibrosis, and these conditions can be largely prevented by a small molecule inhibitor of CCR1 PMID: 20870892
  35. Absence of TLR3 in skin-injured mice leads to defective recruitment of neutrophils and macrophages, in association with decreased expression of the chemokines MIP-2/CXCL2, MIP-1alpha/CCL3, and MCP-1/CCL2 in the wound. PMID: 21317384
  36. MIP-1alpha and interferon-gamma production by CD1d-restricted natural killer (NK)T cells contributes to immune complex-induced acute lung injury. PMID: 21191075
  37. Maternal cells can migrate through the blood-placenta barrier even in the absence of fetal CCL3 in mice. PMID: 20567093
  38. This work demonstrates that the development of F. hepatica is not affected by the absence of CCL3. PMID: 20643506
  39. These results suggest that peripheral nerve injury elicits the up-regulation of spinal MIP-1alpha and CCR1 to participate in neuropathic pain. PMID: 20692319
  40. results suggest a close association between the MIP-1alpha response and the Th1-type T-cell responses in chlamydial lung infections PMID: 20622889
  41. Results show that CCL3 regulates the balance of T cell populations in the lung and can alter the outcome of RSV infection. PMID: 20195359
  42. In conclusion, we propose a novel critical molecule MIP-1alpha derived from macrophages and Schwann cells that appears to play a crucial role in the development of neuropathic pain induced by PSL. PMID: 20223588
  43. OGT could be a co-regulatory subunit shared by functionally distinct complexes supporting epigenetic regulation of MIP-1alpha gene promoter. PMID: 20206135
  44. Studies demonstrate that CCL3 plays a major role in mediating GVHD, but not graft-versus-leukemia. PMID: 20100934
  45. CCL3 is a potent downstream effector of tumor necrosis factor-mediated inflammation in vitro and in vivo. PMID: 20164426
  46. we identified a novel role for neutrophil-secreted CCL3 in the first wave of dendritic cells recruitment to the site of infection with L. major PMID: 20140197
  47. Data verified that the expression of CCR5 and its ligands, CCL3, CCL4 and CCL5, were increased in the thymus with age. PMID: 20046229
  48. MIP-1a is the key substrate in the lung for matrix metalloproteinase-8 during lipopolysaccharide-mediated acute lung injury in mice. PMID: 20042585
  49. GA exhibits antiinflammatory effects through inhibition of MIP-1alpha in a mouse model of acute P. acnes-induced inflammatory liver injury. PMID: 19897483
  50. MIP-1alpha, MIP-1beta, RANTES, and ATAC/lymphotactin function together with IFN-gamma as type 1 cytokines. PMID: 11972057

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Expressed in lung, spleen, and pancreas.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*