Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3), partial

Code CSB-YP006253MO1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP006253MO1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP006253MO1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP006253MO1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Cxcr3; Cmkar3; C-X-C chemokine receptor type 3; CXC-R3; CXCR-3; Interferon-inducible protein 10 receptor; IP-10 receptor; CD antigen CD183
Species
Mus musculus (Mouse)
Expression Region
1-52
Target Protein Sequence
MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR
Protein Length
partial, the first extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response. Binds to CCL21.
Gene References into Functions
  1. The data illustrate the paradoxical pro-tumor role for CXCR3 in lung immunobiology wherein the CXCR3 axis drives both the anti-tumor effector cell chemoattraction and pro-tumor infiltration of the lungs and suggests a potential therapeutic target for lung-tropic metastasizing cancers. PMID: 28358049
  2. the data suggest that CXCR3 and the integrin alpha4 mediate T cell recruitment to uninfected salivary glands but that redundant mechanisms mediate T cell recruitment after Murine Cytomegalovirus infection. PMID: 29288198
  3. The data of this study suggested that spinal CXCR3 mediates chronic itch and alloknesis, and targeting CXCR3 may provide effective treatment for chronic pruritus. PMID: 28401489
  4. Study provided the evidence that CXCL10/CXCR3 signaling in periaqueductal gray is involved in the development of morphine analgesic tolerance via neuron-microglia interaction. PMID: 28755808
  5. The results demonstrate that the recruitment of peripheral immune cells into the CNS, induction of neuroinflammation, and consecutive weight loss during herpes encephalitis is modulated by CXCR3 signaling. PMID: 28116674
  6. results show an important role for CXCR3 and CXCL10 in the tissue distribution of preimmune memory phenotype CD8 T- cells PMID: 29187588
  7. Our data suggests that the altered gene profiles induced by CXCR3 deficiency promotes autoimmune cholangitis through pathogenic CD8(+) T cells. PMID: 28129932
  8. Data suggest that the CXCL9-CXCR3 axis plays a pivotal role in the liver-specific distribution of TRAIL+ NK cells in mice. PMID: 29088306
  9. study thus shows that lung mucosal-resident memory T cells are not generated following systemic TB immunization and that local inflammation is required for systemically activated T cells to home to lung mucosa, which is mediated by interaction between CXCR3 upregulated in these cells and its ligands IP-10 and MIG PMID: 28827285
  10. Antigen targeting to DEC-205 on dendritic cells leads to an IL-10-dependent downregulation of CXCR3 expression on differentiated antigen-specific Th1 cells in vivo. This downregulation interferes with the migration of Th1 cells into the gut and protects mice against severe acute and relapsing intestinal inflammation. PMID: 26732675
  11. this study shows that neutrophils and NK cells act as important disease-promoting immune cells in experimental osteoarthritis and their functional interaction is promoted by the CXCL10/CXCR3 axis PMID: 28108560
  12. These results demonstrate a critical role for both BLT1 and CXCR3 in cytotoxic T lymphocyte (CTL) migration to tumors and thus may be targeted to enhance efficacy of CTL-based immunotherapies. PMID: 27465528
  13. Our studies suggest that CXCR3 is a key contributor to the pathogenesis of Alopecia areata by mediating the infiltration of autoreactive CD8+NKG2D+ T cells into the skin PMID: 27412416
  14. Cxcr3 is up-regulated by DNA demethylation and interaction with C/EBPalpha which contributes to neuropathic pain. PMID: 28100749
  15. These findings demonstrate that the CXCL10/CXCR3 chemokine pathway is critical in shaping CD8(+) T cell immunity, locally within latently infected tissues, which protects against recurrent herpesvirus infection and disease. PMID: 28468883
  16. this study shows that although T cell-specific expression of CXCR3 promotes the accumulation of CXCR3-expressing T cells during Leishmania donovani infection, this does not enhance resistance to visceral leishmaniasis; hepatic granuloma formation is impaired in CXCR3 transgenic mice PMID: 27614845
  17. up-regulated in sepsis-induced acute lung injury PMID: 27565063
  18. beta4GalT1 can regulate N-glycans of CXCR3 in RA. N-glycans of CXCR3 affects CXCL10/CXCR3 ligand-binding which enhancing fibroblast-like synoviocytes invasion. PMID: 28215986
  19. this study shows that diosgenin-mediated anti-allergic effects are associated with increased number of Foxp3+ Treg cells expressing CXCR3 PMID: 27886644
  20. Circulating levels of chemokines that activate CXCR3 are elevated in non-obese diabetic (NOD) mice, consistent with clinical findings in human diabetes. PMID: 27325565
  21. CXCR3 interacts with IL-10 secreted by CD8+CD122+ regulatory T cells in a mouse model of Acute Lung Injury and promotes interferon-gamma and CXCL10 release. PMID: 26475448
  22. This study demonstrates a previously unrecognized role of CXCR3 signaling in glial cells in negatively regulating Th17 cell expansion during experimental autoimmune encephalomyelitis PMID: 27068264
  23. CXCR3 was also linked to steatosis through inducing hepatic lipogenic genes PMID: 26394162
  24. findings demonstrate that targeting CXCR3 is effective in both tumor and host compartments, and suggest that CXCR3 inhibition is likely to avoid adverse effects on host cells PMID: 26485767
  25. Activation of the CXCL10/CXCR3 pathway has an important role in retinal inflammation and neuronal injury after high intraocular pressure-induced ischemia. PMID: 26448323
  26. STAT3 in CD8+ T Cells Inhibits Their Tumor Accumulation by Downregulating CXCR3/CXCL10 Axis PMID: 26025380
  27. CXCR3-mediated trafficking of regulatory T cells could represent a mechanism of homeostatic immunoregulation during diabetogeneesis. PMID: 25946021
  28. These studies identify CXCR3-mediated trafficking at the tumour vascular interface as a critical checkpoint to effective T-cell-based cancer immunotherapy. PMID: 26109379
  29. activated T cells display a subtle distance-dependent chemotaxis toward clusters of infected cells and this is mediated by CXCR3 and its ligands. PMID: 26525288
  30. results suggest that CXCR3 plays an important role in recruiting proinflammatory cells to the colon during colitis and that CXCR3 may be a therapeutic target to reduce the influx of proinflammatory cells in the inflamed colon. PMID: 24992040
  31. MOG(1-125) immunization resulted in an increased incidence of severe experimental autoimmune encephalomyelitis and was accompanied by an increased percentage of CXCR3-expressing CD4+ T cells producing IFNgamma in the CNS. PMID: 24552747
  32. Data indicate that dipeptidylpeptidase 4 (DPP4) diminishes chemokine CXCL10 expression and limits CXC Chemokine Receptor 3 (CXCR3)-mediated antitumor immunity. PMID: 26075911
  33. Maternal CD8+ T cells with fetal specificity upregulated expression of the chemokine receptor CXCR3 and were essential for L. monocytogenes-induced fetal resorption in prenatal L. monocytogenes infection. CXCR3 knockout or blockade prevented this. PMID: 25751061
  34. The anti-fibrotic effects of CXCL10 in the healing infarct and in isolated cardiac fibroblasts are CXCR3-independent and may be mediated through proteoglycan signalling PMID: 24891401
  35. CXCR3-dependent recruitment of cells to inflamed areas was critical for development of the CD8-positive, CD103-negative T lymphocyte population and pathogen clearance. PMID: 25706747
  36. CXCR3 enables local CD8(+) T cell migration for the destruction of virus-infected keratinocytes. PMID: 25769612
  37. CXCR3 signaling mediates development of Alzheimer disease-like pathology in APP/PS1 mice. PMID: 25500888
  38. The CXCR3 chemokine system is critically involved in the intrinsic glial activation during cuprizone-induced demyelination, which significantly modulates the distribution of glial cells and the local cytokine milieu. PMID: 24930935
  39. plays a role in insulin resistance and obesity-induced visceral adipose inflammation PMID: 24124129
  40. this is the first report that demonstrates a role for CXCR3 in macrophage polarization and subsequent breast tumor outcomes PMID: 24679047
  41. In our mouse model, fatal progression of AIH is mediated by IL-18-dependent differentiation of T cells into Th1 cells and effector T cells, respectively, and that CXCR3-CXCL9 axis-dependent migration of those T cells is crucial for fatal progression. PMID: 24700550
  42. CXCR3 contributes to T-cell accumulation in periepididymal adipose of obese mice. PMID: 24812325
  43. CCR4 and CXCR3 play different roles in the migration of T cells to inflammation in skin, arthritic joints, and lymph nodes. PMID: 24700244
  44. CXCR3 is critical to the skin-selective effector T-cell recruitment underlying autoreactive GVHD PMID: 24390137
  45. Data indicate that NOD2 is required for CXCR3-dependent small intestinal (SI) CD8(+) T cell migration during T cell activation. PMID: 24591373
  46. results establish a central role for CXCR3 in coordinating innate and adaptive immunity, ensuring generation of Th1 effectors and their trafficking to the frontline of infection to program microbial killing by inflammatory monocytes. PMID: 24130498
  47. blockade or genetic deficiency of either CXCR3 or of its primary ligand has no impact on clinical experimental autoimmune encephalomyelitis induced by the adoptive transfer of highly polarized Th1 effector cells. PMID: 23873018
  48. The data show that CCL21 and CXCR3 have dichotomous functions in traumatic and autoimmune encephalomyelitis-evoked neuropathic pain suggesting PMID: 23643685
  49. Expression of the chemokine receptor CXCR3 was critical for memory CD8(+) T cells to populate the airways during the steady state. IL-12 signaling shortly after immunization limited CXCR3 expression on memory CD8(+) T cells. PMID: 24238342
  50. early differentiated CD138(high)MHCII(+) rather than terminally differentiated CD138(high)MHCII(low) plasma cells may be involved in the renal inflammatory injury in lupus, due to CXCR3 expression and IgG secretion. PMID: 23520491

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expresses in lymphoid organs and Th1 cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1