Recombinant Mouse C-X-C chemokine receptor type 3(Cxcr3)

Code CSB-CF006253MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O88410
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYS LLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGP GLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLL FALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAV LLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMDVGVLARNCGRESHVDVAKS VTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQRGPQRQPSSSRRESSWSETT EASYLGL
Source in vitro E.coli expression system
Gene Names Cxcr3
Protein Names Recommended name: C-X-C chemokine receptor type 3 Short name= CXC-R3 Short name= CXCR-3 Alternative name(s): Interferon-inducible protein 10 receptor Short name= IP-10 receptor CD_antigen= CD183
Expression Region 1-367
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response (By similarity). Binds to CCL21.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expresses in lymphoid organs and Th1 cells.
Database Links

KEGG: mmu:12766

STRING: 10090.ENSMUSP00000052444

UniGene: Mm.12876

Pathway Chemokine signaling pathway

Related Products

Cxcr3 Proteins

Cxcr3 Proteins for Mus musculus(Mouse)

Cxcr3 Proteins for Mus musculus (Mouse)

Cxcr3 ELISA Kit

Cxcr3 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.