Recombinant Mouse Cathepsin K (Ctsk)

In Stock Promotion
Code CSB-EP006192MO
Abbreviation Recombinant Mouse Ctsk protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ctsk; Cathepsin K; EC 3.4.22.38
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
115-329aa
Target Protein Sequence
VPDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKKKTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNGGIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALLARNKNNACGITNMASFPKM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol protease involved in osteoclastic bone resorption. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Involved in the release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen.
Gene References into Functions
  1. these data indicate that CatK not only plays a major role in bone remodeling but also modulates modeling-based cortical bone formation by degrading periostin and thereby moderating Wnt-beta-catenin signaling. PMID: 28322464
  2. This study established a possible role of CatK in TLR7 proteolytic activation, Treg immunosuppressive activity, and lupus autoimmunity and pathology. PMID: 28093526
  3. catK deficiency almost completely blunted the increased vascular remodeling response of apoE-/- mice to flow cessation, possibly by correcting hyperlipidemia-associated pro-inflammatory effects on the peripheral immune response PMID: 27636705
  4. Cathepsin K expression is increased in the bone of a diabetic mouse model. PMID: 26892148
  5. Data suggest Ctsk gene, key gene upregulated during osteoclast differentiation, is transcriptionally activated during cell hypoxia-induced mitochondrial dysfunction/disruption; hnRNPA2 (heterogeneous ribonucleoprotein A2) is coactivator in this process. PMID: 25800988
  6. cathepsin K knockout attenuates age-related decline in cardiac function via suppressing caspase-dependent and caspase-independent apoptosis PMID: 25692548
  7. Data (including data from studies in knockout/transgenic mice) suggest that Ctsk is involved in inflammatory response and bone resorption in both rheumatoid arthritis and periodontitis; thus, Ctsk appears to play a role in osteoimmune responses. PMID: 25896020
  8. In a mouse model of post-traumatic osteoarthritis, cathepsin K activity was significantly increased in injured knees relative to uninjured knees. PMID: 25278057
  9. Gene deletion of cathepsin K in mice accelerated callus size resolution, significantly increased callus mineralized mass, and improved mechanical strength as compared to wild type mice. PMID: 24928497
  10. synergism between HIV proteins and pro-atherogenic shear stress to increase endothelial cell expression of the powerful protease cathepsin K PMID: 24719048
  11. in addition to its other effects, the absence of CatK in OCP limits their ability to engraft in a repairing fracture callus compared to WT OCP. PMID: 24590570
  12. Cardiac mammalian target of rapamycin and extracellular signal-regulated kinases (ERK) signaling cascades were upregulated by pressure overload, the effects of which were attenuated by cathepsin K knockout. PMID: 23529168
  13. The localization pattern of the intercellular junction proteins E-cadherin and occludin was altered in the colon of Ctsk-/- mice, suggesting potential impairment of the barrier function. PMID: 23152408
  14. Targeted ablation of Ctsk in hematopoietic cells, or specifically in osteoclasts and cells of the monocyte-osteoclast lineage, resulted in increased bone volume and bone formation rate as well as osteoclast and osteoblast numbers. PMID: 23321671
  15. cathepsin K contributes to the development of obesity-associated cardiac hypertrophy and may represent a potential target for the treatment to obesity-associated cardiac anomalies. PMID: 23069627
  16. cathepsin K exocytosis is controlled by PKCdelta through modulation of the actin bundling protein myristoylated alanine-rich C-kinase substrate. PMID: 22806935
  17. results raise significant concerns regarding in vivo bone phenotypes created using Ctsk(Cre/+) mice and warrant further investigation into the role of Cathepsin K in gametes as well as alternative tools for studying osteoclast-specific gene loss in vivo PMID: 22860046
  18. CTK plays crucial direct roles in the early to intermediate stage of osteoarthritis development. CTK-positive chondrocytes and synovial cells may be a possible target to prevent disease progression in osteoarthritis. PMID: 21968827
  19. This study demonstrates that curcumin increases the expression of cathepsins K and L in lung which an effect on lung fibroblast cell behavior. PMID: 22126332
  20. We propose that cathepsin K activity has an important impact on the development and maintenance of the CNS in mice PMID: 21794126
  21. variants of ENaC subunits may contribute to the variation of BP response to dietary sodium intake PMID: 21721952
  22. CatK plays an essential role in abdominal aortic aneurysm formation by promoting T-cell proliferation, vascular SMC apoptosis, and elastin degradation and by affecting vascular cell protease expression and activities. PMID: 21817099
  23. BK channel controls resorptive osteoclast activity by regulating Cathepsin K release PMID: 21695131
  24. Airway development is partly regulated by cathepsin K expression contributes to lung development the maintenance of the airway structural integrity via an interaction with TGF-beta1. PMID: 21627832
  25. Cathepsin K deficiency affected mostly the occurrence and composition of lung granulomas in a murine model of sarcoidosis. PMID: 21251246
  26. the levels of cathepsin K and MMP-9 increase in the conditioned medium from IL-17A-treated cells PMID: 20937352
  27. while catK deficiency has major impact on various vasculopathies, it did not affect murine aneurysm formation. PMID: 19775691
  28. Data indicate that cathepsin K ablation in mice results in reduced body fat content under conditions requiring a rapid accumulation of fat stores. PMID: 17668061
  29. Results suggest that the accumulation of glycosaminoglycans in murine mucopolysaccharidosis I bone has an inhibitory effect on cathepsin K activity, resulting in impaired osteoclast activity and decreased cartilage resorption. PMID: 19834056
  30. Cathepsin K-deficient osteoclasts are fully differentiated and are capable of degrading the organic phase of alveolar bone during tooth formation and eruption in CK-/- knockout mice. PMID: 12719657
  31. cathepsin K has a role in utilization of luminal thyroglobulin for thyroxine liberation PMID: 12782676
  32. Cathepsin K plays a pivotal role in lung matrix homeostasis under physiological and pathological conditions. PMID: 15161653
  33. Altogether, these data suggest that while Cat K may contribute to control lung fibrosis, TGF-beta appears to limit its overexpression in response to silica particles PMID: 16045809
  34. overexpression of the cathepsin K gene under its own promoter in transgenic mice makes them susceptible to progressive synovitis PMID: 16329095
  35. Scavenger receptor-mediated uptake (particularly by CD36) of modified LDL increased in the absence of catK, resulting in an increased macrophage size because of increased cellular storage of cholesterol esters, thereby enlarging the lysosomes PMID: 16365196
  36. CatK-deficient mice were generated by targeted disruption of the Ctsk gene and compared their bone structural and mechanical properties with wildtype (WT) controls. PMID: 16753017
  37. Cathepsin K is a mechanosensitive, extracellular matrix protease that may be involved in arterial wall remodeling and atherosclerosis. PMID: 17098827
  38. cathepsin K plays a key role in osteoclasts apoptosis and senescence, revealing the importance of osteoclasts senescence in bone homeostasis. PMID: 17210673
  39. AP-1 stimulates the cathepsin K promoter in RAW 264.7 cells. PMID: 17897792
  40. results suggest cathepsin K plays an important role in the immune system; pharmacological inhibition or targeted disruption of cathepsin K resulted in defective Toll-like receptor 9 signaling in dendritic cells in response to unmethylated CpG DNA PMID: 18239127
  41. experiments raise doubts about a crucial role of cathepsin K in arthritic bone destruction PMID: 18240253
  42. cathepsin K deficiency appears to increase lesion stability in brachiocephalic arteries by maintaining the integrity of the tunica media and by decreasing plaque vulnerability to rupture PMID: 18291403
  43. essential role of CatK in adipogenesis and body weight gain, possibly via degradation of fibronectin PMID: 18818416
  44. CTSK may play a role in adipogenesis in early differentiation phases and produce an effect at least partly by degrading type I collagen. PMID: 18840928
  45. The purpose of this paper is to describe bone mass, strength, resorption, and formation in young adult CatK null mice. PMID: 18845279
  46. Leucocyte CatK is an important determinant of atherosclerotic plaque composition, vulnerability, and bone remodelling. PMID: 19015136
  47. cathepsin K interaction with type I collagen is required for 1) the release of cryptic Arg-Gly-Asp motifs during the initial attachment of osteoclasts and 2) termination of resorption PMID: 19028686
  48. increased biosynthesis of cathepsin K was sufficient to accelerate the osteoclastic bone resorption cycle. PMID: 19118660
  49. Free cholesterol accumulation in macrophage membranes activates Toll-like receptors and p38 mitogen-activated protein kinase and induces cathepsin K. PMID: 19122179
  50. the hypercalcification of the cathepsin K-deficient growth plate is due to persistence of calcified cartilage and point to a role of cathepsin K in bone tissue development as well as skeletal remodeling. PMID: 19172215

Show More

Hide All

Subcellular Location
Lysosome. Secreted. Apical cell membrane; Peripheral membrane protein; Extracellular side.
Protein Families
Peptidase C1 family
Tissue Specificity
Predominantly expressed in bones. Expressed in thyroid epithelial cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*