Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU). The EC50 is 141.7-172.4 ng/mL.

Target Names

Glp1r

Uniprot No.

O35659

Alternative Names

Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R;Glp1r

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

22-145aa

Target Protein Sequence

GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY

Mol. Weight

15.8 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

GLP-1R mediates incretin signaling central to glucose homeostasis and is a validated target for metabolic disease therapeutics, yet studying its extracellular domain in isolation requires a protein that preserves native epitope presentation. This mammalian-expressed fragment spanning residues 22–145 captures the N-terminal ligand-binding domain and demonstrates functional binding to an anti-GLP1R recombinant antibody with an EC50 of 141.7–172.4 ng/mL in ELISA, confirming conformational integrity suitable for antibody epitope mapping, competitive inhibition screening, and therapeutic antibody validation studies. The low endotoxin level (< 1.0 EU/μg) and > 90% purity meet the quality thresholds commonly required for surface plasmon resonance and biolayer interferometry experiments characterizing receptor-ligand affinity or screening small-molecule modulators. Researchers developing GLP-1R-targeted biologics or investigating incretin receptor pharmacology can use this protein as a positive control in binding assays or as an immobilized ligand for drug discovery campaigns.

Target Background

Function

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.

Gene References into Functions

Study shows that GLP-1 receptor signalling promotes beta-cell glucose metabolism via mTOR-dependent HIF-1alpha activation. findings suggest that chronic GLP-1 actions on insulin secretion include elevated beta-cell glucose metabolism. Moreover, our data reveal novel aspects of GLP-1 stimulated insulin secretion involving de novo gene expression. PMID: 28572610
chronotherapeutic modulation of vagal afferent GLP-1R signaling may aid in treating metabolic disorders. PMID: 29317623
Presynaptic GLP-1 receptors enhance the depolarization-evoked release of glutamate and GABA in the mouse cortex and hippocampus. PMID: 29265673
This study presents an unexpected proinflammatory switch from Galphas to GalphaI glp1r signaling in burn monocytes which promotes ERK1/2 and NF-kappaB activation PMID: 29022064
GLP-1R signaling in paraventricular thalamic nucleus plays a role in food intake control. PMID: 28811669
GLP-1 receptor agonists suppress the progression of atherosclerosis by inhibiting vascular smooth muscle cell proliferation and enhancing AMP-activated protein kinase and cell cycle regulation in ApoE deficient mice. PMID: 28445811
IL-33, GLP-1R, and CCL20 are deregulated in human inflammatory bowel disease. GLP-1 receptor agonists upregulate IL-33, mucin 5b, and CCL20 in murine Brunner's glands. GLP-1 receptor agonists affect gut homeostasis in both proximal and distal parts of the gut. PMID: 27542128
findings identify a group of proteins that interact with GLP-1R and show that one specific interacting protein, SERP1, has an important role in facilitating the glycosylation of GLP-1R and rescuing its activities after ER stress induced by tunicamycin. PMID: 28597972
Suggest transcription factor 7-like 2 is a possible regulator of glucagon-like peptide 1 receptor expression in endothelial/smooth muscle cells in diabetic mice. PMID: 28830217
ventromedial hypothalamus GLP-1R regulates food intake by engaging key nutrient sensors but is dispensable for the effects of GLP-1RA on nutrient homeostasis PMID: 28811293
GLP-1R is highly expressed within the lateral septum. PMID: 27187231
Study showe that GLP-producing fibers interact with hypothalamic arcuate nucleus (ARC) Kiss1 cells that express GLP-1R, and GLP-1R signaling directly activates ARC Kiss1 function in an estradiol-independent manner. Pharmacological activation of GLP-1R signaling during fasting or pharmacological inhibition of CNS GLP-1R signaling during normal feeding does not alter circulating luteinizing hormone levels. PMID: 28144621
The increased calcium response mediated by secretin in the absence of GLP-1R was paralleled by an increased glucose-dependent insulin response, indicating that the heterodimeric receptor complexes modulate secretin responses. PMID: 28368447
Menin and PRMT5 suppress GLP1R transcript levels and PKA-mediated phosphorylation of FOXO1 and CREB. PMID: 28270438
Glp1r knockdown reduced anxiety-like behavior, implicating paraventricular nucleus GLP-1 signaling in behavioral stress reactivity PMID: 28053040
Enhanced beta-cell GLP-1R signaling contributes to improved glucose regulation after vertical sleeve gastrectomy by promoting increased glucose-stimulated insulin secretion. PMID: 27501183
Results suggest a detectable but only modest role for GLP-1R signaling in mediating the effects of Roux-en-Y gastric bypass and that this role is limited to its well-described action on glucose regulation. PMID: 27026085
Hypothalamic Glp1r is sufficient but not necessary for regulation of energy balance and glucose homeostasis. PMID: 27908915
Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose. PMID: 27020250
present study provides critical insights regarding the nature by which GLP-1 signaling controls reinforced behaviors and underscores the importance of both peripheral and central GLP-1R signaling for the regulation of addictive disorders. PMID: 27072507
These differential effects of exogenous Glp1r in nondiabetic and diabetic mice suggest that downregulation of Glp1r might be required to slow the progression of beta-cell failure under diabetic conditions. PMID: 26854076
although endogenous GLP-1R signalling contributes to increased brown adipose tissue thermogenesis, this mechanism does not play a significant role in the food intake-independent body weight lowering effect of the GLP-1 mimetic liraglutide in obese mice PMID: 26049402
GLP-1R is present in pancreatic acinar cells and that GLP-1 can regulate secretion through its receptor and cAMP signaling pathway. PMID: 26542397
GLP1R is expressed in mouse retina. GLP-1R protein abundance was independent of the presence of diabetes. PMID: 26384381
The data of this study reveal a novel role of GLP-1R in dorsal lateral septum function driving behavioral responses to cocaine. PMID: 25669605
GLP-1R agonism significantly reduced alcohol consumption in a mouse model of alcohol dependence. PMID: 26080318
these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo. PMID: 26302449
These results support a role for extra islet GLP1R in oral glucose tolerance and paracrine regulation of beta cells by islet GLP-1. PMID: 24836562
For the binding between 125I-liraglutide and the GLP-1 receptor on the surface of INS-1 cells, the equilibrium dissociation constant (Kd) was 128.8 +/- 30.4 nmol/L(N = 3), and the half-inhibition concentration (IC50) was 542.4 +/- 187.5 nmol/L(N = 3). PMID: 24805918
GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats. PMID: 25656368
our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2. PMID: 24866833
GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight loss PMID: 25202980
GLP-1R signaling upregulates renal NAD(P)H oxidase and increases renal oxidative stress, with reduced levels of renal cAMP-PKA activity in the setting of chronic hyperglycemia accentuating the progression of diabetic nephropathy. PMID: 24152968
Activation of GLP-1R in spinal cord leads to antinociception in pain hypersensitivity. PMID: 25247855
GLP-1R is shown to be a recycling receptor. PMID: 24275181
Binding of the novel ligand [125I]GLP-1(9-36) is studied in mouse tissues as well as the parameters of equilibrium dissociation constant, functional activity, and GLP-1 receptor density, compared with GLP-1(7-36). PMID: 24641952
Exenatide requires a functional GLP-1R to exert chronic metabolic effects in mice. PMID: 24477544
Our findings indicate that the GLP-1r is involved in ileal enterocyte and Paneth cell function PMID: 23927844
The results provide no support for important individual roles of either gut hormone in the specific mechanisms by which RYGB rats settle at a lower body weight. PMID: 24430883
A novel GLP-1R-protein interactome was generated, identifying several interactors that suppress GLP-1R signaling. PMID: 23864651
mice lacking GLP1R appear to have decreased bone strength observed at anatomical level with decrease in 3-point bending resistance and decreased Ct.Th. Bone strength was reduced at tissue level and was associated with reductions of collagen cross-linking PMID: 23911987
GLP-1R agonism reverses cardiac remodeling and dysfunction observed in T2DM via normalizing imbalance of lipid metabolism and related inflammation/oxidative stress. PMID: 23709595
there is a gut-heart GLP-1R-dependent and ANP-dependent axis that regulates blood pressure and involves Epac2 PMID: 23542788
Functional disruption of the Glp1r results in exercise-induced hyperglycaemia associated with an excessive increase in glucagon secretion and hepatic glucose production PMID: 22890715
Activation of the central GLP-1R reduces food intake via glucose metabolism-dependent inhibition of central AMPK. Fructose stimulates food intake by impairing central GLP-1R action. PMID: 23341495
GLP-1 receptor activation inhibits VLDL production and reverses hepatic steatosis by decreasing hepatic lipogenesis in high-fat-fed APOE*3-Leiden mice PMID: 23133675
Data suggest that both glucagon-like peptide 1/Glp1r signal transduction and glucagon receptor activity in central nervous system are involved in control of interscapular brown adipose tissue thermogenesis. PMID: 22933116
GLP-1 and liraglutide activate the GLP-1R, thereby promoting pre-adipocyte proliferation and inhibition of apoptosis. PMID: 22207759
C-cell effects in mice are mediated via the GLP-1 receptor and not associated with RET activation PMID: 22234463
low levels of endogenous GLP-1 secreted from gut endocrine cells are capable of augmenting glucoregulatory activity via pancreatic GLP-1Rs independent of communication with neural pathways PMID: 22182839

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Tissue Specificity

Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs.

Database Links

KEGG: mmu:14652

STRING: 10090.ENSMUSP00000110221

UniGene: Mm.390969

Code	CSB-MP009514MO1
Abbreviation	Recombinant Mouse Glp1r protein, partial (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/ml can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU). The EC₅₀ is 141.7-172.4 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage